SecReT4
Protein ID: 154244559
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0604
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]677235..678482 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA7ICW7
KEGG IDxau:Xaut_0604
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-63, Aligned region: 232..410
Protein Sequence: 415 a.a.     [Download]
>gi|154244559|ref|YP_001415517.1| conjugation TrbI family protein [Xanthobacter autotrophicus Py2]
MNGMDPGKKKGLGSAGDGGSPPLTGEATAAMRLRPEPPRVTRLSRKVLAGLGLVAGLGIGGALIFALQTR
KDHGLGQELYATDIKATPDGLAGLPKDYTGIPKLGPPLPGDLGRPILNAQTVAQPPLPSMAGMPNPALSP
EEQRQQQESEAARTGRLFAQTITRPASSVVAQQVGAASITTAAPVPDLTSLGLAPPAATPTAQERQVAFL
NLAVDRRTVSPDRVAAPASVNILQAGAVIPAALITGIRSDLPGQITAQVTENVHDSPTGRILLIPQGTRI
IGQYDNGVGFGQRRILLVWNRLIFPNGRSIVLERQPGADAEGYAGLEDGVDYHWGELFKTAVLSTILSVG
ASAGSSGSNSDLASALREGASDSISQTGRQIVQRQLNIAPTLTIRPGYPVRVIVTRDLVLEPYGG
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|154243958|ref|NC_009720.1|:677235-678482 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGAACGGCATGGACCCCGGAAAGAAGAAAGGGCTGGGTTCGGCTGGCGATGGCGGCTCCCCGCCGCTGA
CGGGGGAGGCTACGGCGGCCATGCGGTTGCGGCCGGAGCCGCCCCGGGTGACACGCCTGTCGCGCAAGGT
ACTGGCCGGGCTGGGGCTCGTCGCTGGCCTCGGGATCGGCGGAGCGCTGATCTTCGCTCTCCAGACGCGA
AAGGACCACGGTCTGGGCCAGGAACTCTACGCCACCGACATCAAGGCGACGCCGGACGGACTTGCCGGCT
TGCCGAAGGACTATACCGGCATCCCTAAGCTCGGGCCTCCGCTGCCCGGCGACCTCGGCCGGCCCATCCT
CAATGCGCAGACGGTAGCGCAGCCGCCACTGCCGTCAATGGCTGGCATGCCTAATCCCGCTCTGAGCCCT
GAGGAGCAGCGCCAGCAGCAGGAGAGCGAGGCCGCGCGGACCGGGCGGCTGTTCGCCCAAACCATCACGC
GGCCGGCAAGCTCTGTCGTGGCGCAACAGGTGGGCGCAGCGTCTATTACGACGGCGGCACCTGTCCCGGA
TCTGACTTCCCTCGGCCTCGCCCCGCCGGCGGCAACACCCACGGCCCAGGAGCGGCAGGTAGCCTTCCTC
AACCTGGCCGTCGACCGCCGCACCGTGTCCCCTGACCGTGTGGCGGCGCCCGCTTCAGTCAACATCCTGC
AGGCGGGCGCCGTCATCCCCGCTGCGCTGATCACCGGCATCCGCTCCGACCTACCGGGTCAAATCACCGC
CCAGGTGACCGAGAATGTCCATGACAGCCCGACCGGCCGGATTCTCCTGATCCCCCAGGGCACGCGCATC
ATCGGTCAGTACGACAACGGCGTCGGCTTCGGGCAGCGACGGATTCTTCTGGTTTGGAACCGGCTGATCT
TCCCCAATGGCCGCTCCATCGTGCTGGAGCGCCAGCCTGGAGCCGATGCCGAAGGCTATGCCGGTCTCGA
AGATGGTGTCGACTATCACTGGGGCGAGCTCTTCAAGACCGCGGTGCTCTCCACCATCCTGAGCGTCGGG
GCGAGCGCCGGTTCATCCGGCAGCAACAGCGACCTTGCGAGCGCTCTGCGGGAAGGGGCTTCCGACAGTA
TCAGCCAGACCGGACGCCAGATCGTCCAGCGTCAGCTCAACATCGCGCCGACGCTCACGATACGGCCGGG
ATACCCGGTGCGGGTCATCGTCACGCGCGACCTCGTTCTCGAACCCTATGGAGGCTGA
 Primer design