SecReT4
Protein ID: 154244642
T4SS name [ID]Trb [273]
Gene symbol-
Locus tagXaut_0691
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]781169..782185 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7ID50
KEGG IDxau:Xaut_0691
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.7e-61, Aligned region: 103..319
Protein Sequence: 338 a.a.     [Download]
>gi|154244642|ref|YP_001415600.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MTRTPIRKSGFPAFRKPAILALLAATALAGCATNRVPQFSYDADVPPLPVVQAPVTDERPRPLHTPPSWN
VARGGAAAGTPAGRVENANAAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQVTNIALEPGEGLTGAG
PIAAGDTARWIIGDTESGSGAHRRVHVLVKPTRPDISTNLVITTDRRIYMIELRAREELYMPAVAWAYPA
PPAGQRRSVPAAPVIPAEAARNYRYGLTGDSPPWRPISVFDDGRRVYVVFPRGIVQGEMPPIFVLGSDGE
PQIVNSRIHQNILIVDRLFGAAELRLGSGERQQTVRIVRIEQRQAAAQPARDTGDSPS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c782185-781169 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACCCGCACGCCGATCCGTAAGTCCGGCTTTCCGGCTTTCCGCAAACCCGCGATCTTGGCCTTGCTGG
CCGCGACGGCGCTGGCTGGATGTGCCACCAATCGGGTTCCTCAGTTCAGCTACGATGCCGACGTGCCGCC
GCTGCCCGTCGTGCAGGCACCTGTCACCGATGAGCGGCCGCGCCCGCTGCACACGCCTCCCTCCTGGAAC
GTGGCACGGGGCGGTGCAGCCGCAGGCACGCCGGCGGGACGGGTGGAGAACGCCAATGCCGCCGCCCGCG
TCGAACCGCGCCGCGAGGGCTATTACAATGCCATCCAGATTTACCCGTGGTCCGAGGGCGCTCTCTATCA
GGTCTATGCGGCGCCGGGGCAGGTCACCAATATCGCCCTGGAGCCAGGTGAGGGCCTGACCGGCGCCGGT
CCGATCGCGGCGGGCGATACCGCACGATGGATCATCGGCGATACCGAGAGCGGAAGCGGTGCGCACCGGC
GTGTTCATGTGCTGGTAAAGCCGACGCGGCCGGACATCTCGACCAACCTCGTCATCACCACCGACCGGCG
CATCTACATGATCGAGCTGCGCGCCCGCGAGGAGCTCTACATGCCTGCCGTCGCTTGGGCCTATCCCGCG
CCACCGGCGGGGCAGCGTCGGTCGGTCCCGGCCGCACCCGTCATCCCGGCCGAGGCGGCGCGCAACTATC
GCTACGGCCTGACCGGCGACAGCCCGCCATGGCGGCCGATCTCGGTCTTCGACGATGGTCGGCGCGTCTA
CGTCGTCTTCCCGCGCGGTATCGTCCAGGGCGAGATGCCGCCGATCTTCGTGCTCGGCTCGGATGGCGAG
CCGCAGATCGTCAACAGCCGCATCCACCAGAACATCCTTATCGTCGACCGCCTGTTCGGTGCAGCCGAGC
TTCGCCTTGGAAGTGGCGAGCGCCAACAGACCGTCCGGATCGTCCGGATCGAACAGCGGCAGGCCGCCGC
CCAGCCCGCCCGCGATACCGGAGACTCGCCATCATGA
 Primer design