SecReT4
Protein ID: 154244644
T4SS name [ID]Trb [273]
Gene symbol-
Locus tagXaut_0693
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]782868..784223 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7ID52
KEGG IDxau:Xaut_0693
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.9e-55, Aligned region: 37..262
Protein Sequence: 451 a.a.     [Download]
>gi|154244644|ref|YP_001415602.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MGGMGVIDNFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYLIGNWNNLAKIVFDSFAGLGLQASGTSFSAADLMRPGRVAQTGLDAGRPLLDAISDLMGFVSFFENFI
QIACLLFAWALVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTAGFGGATPTIDDAMAIVLAALSLLGLGIFGPGIASGLVSGGPQLGAGSAVGTGLA
AGGMVLAGGAAAGMAARGGAAALSGGAAAVRGGATAAGGATAAYSVGSLGQSGAAGVVSGLGGVTRAAGS
AAASPLKRAASRAHESVRSSFSDGVRAGFGATGGSSSMGTVGGAGDAAAASASAGAPPAWAQRMQRRQAL
GHGTTMAGHAVRSGDSHGSGSSVNLSESDRS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c784223-782868 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGGGCGGGATGGGGGTCATCGACAATTTTCTCGGCGTCTTCACGAGCTATATCGACAGCGGATTCGGGT
TGCTCGGCGGCGAAGTCGCCTTCATCGCGACTACGCTGATCGTCATCGATGTGACGCTCGCGGCTCTGTT
CTGGAGCTGGGGTGCCGACGACGACATCATCGCCCGGCTGGTGAAGAAGACCCTCTTCGTCGGTGTCTTC
GCCTACCTGATCGGCAACTGGAACAATCTCGCGAAGATCGTTTTCGACAGCTTTGCGGGACTCGGCCTGC
AAGCCTCCGGGACCAGTTTTTCCGCTGCCGATCTGATGCGCCCCGGCCGCGTCGCGCAGACAGGCCTCGA
TGCAGGTCGACCGCTGCTCGATGCGATCTCGGATCTGATGGGCTTCGTTTCCTTCTTCGAGAATTTCATC
CAGATCGCCTGCCTGCTGTTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCATCCTTGCGATCCAGCTCT
TCGTCACGCTAATCGAGTTCAAGCTGACGACGCTTGCCGGGTTCGTCCTCATTCCCTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGTGTGCTCGGCAACGTCGTCTCCTCCGGCATCAAGGTGCTCGTCCTC
GCCGTCATCATCGGCATCGGCTCGACGCTGTTTTCCCAGTTCACCGCCGGTTTCGGCGGCGCGACACCTA
CCATCGACGATGCCATGGCGATCGTGCTGGCCGCTCTCTCCCTTCTCGGTCTCGGCATCTTCGGCCCCGG
TATCGCCTCGGGCCTTGTCTCGGGCGGGCCGCAGCTCGGCGCCGGCTCGGCTGTCGGCACCGGCCTTGCC
GCCGGTGGTATGGTGCTGGCGGGAGGCGCCGCCGCAGGCATGGCCGCAAGGGGAGGCGCGGCCGCCCTGT
CGGGAGGAGCCGCGGCCGTCCGCGGTGGCGCGACCGCCGCGGGAGGCGCCACAGCCGCCTATAGCGTCGG
ATCGCTGGGCCAGTCCGGTGCGGCAGGTGTCGTCTCCGGTCTTGGAGGTGTCACCCGGGCAGCCGGTTCC
GCCGCCGCCTCGCCGCTGAAACGCGCCGCCTCCAGGGCACACGAGAGCGTCCGGTCCAGTTTCTCCGACG
GTGTTCGCGCCGGGTTCGGCGCGACAGGCGGGTCATCTTCCATGGGCACCGTCGGCGGCGCAGGCGATGC
CGCCGCCGCATCGGCCTCCGCTGGCGCTCCTCCGGCCTGGGCGCAGCGGATGCAGCGCCGACAAGCGCTT
GGCCACGGCACGACCATGGCGGGCCATGCCGTGCGCTCCGGCGACAGCCACGGCTCCGGCTCTTCCGTCA
ATCTCTCCGAAAGCGACCGCTCATGA
 Primer design