SecReT4
Protein ID: 154244649
T4SS name [ID]Trb [273]
Gene symbol-
Locus tagXaut_0698
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]788143..788475 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7ID57
KEGG IDxau:Xaut_0698
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.2e-25, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|154244649|ref|YP_001415607.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MIRHALRMRRHVATAAAVTYVSLFMAPAAHASGSSMPWEAPLQSILESIEGPVAKIIAVIIIIVTGLTLA
FGDTSGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c788475-788143 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATCCGTCACGCCTTGCGCATGCGCCGTCACGTCGCGACAGCCGCGGCCGTCACCTATGTCAGCCTGT
TCATGGCCCCGGCCGCTCATGCGTCCGGGTCATCCATGCCCTGGGAGGCGCCGCTCCAGAGCATTCTCGA
ATCGATCGAGGGACCGGTCGCGAAGATCATCGCCGTCATCATTATCATCGTGACCGGCCTGACGCTGGCC
TTCGGCGACACCTCTGGCGGCTTCCGGCGACTGATCCAGATCGTCTTCGGCATCTCCATCGCCTTCGCGG
CATCGAGCTTCTTTCTGTCCTTCTTCTCGTTTGGTGGCGGGGCGCTCATCTGA
 Primer design