SecReT4
Protein ID: 154244692
T4SS name [ID]Trb [274]
Gene symbol-
Locus tagXaut_0741
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]828581..829606 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7IDA0
KEGG IDxau:Xaut_0741
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-71, Aligned region: 110..334
Protein Sequence: 341 a.a.     [Download]
>gi|154244692|ref|YP_001415650.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MKPSFRKAGNPASRTSTFTILLLCTSALAGCATANRPPEISYDDAVPAALSANPPAPVRVVELPRPLPLP
GQMKPVEPSRGTPEPTDPTARVNQANAAARVQPVRDGFINAMQVYPYTGGALYQVYTAVGQITDIALQPG
EQLVGSGPVAAGDTVRWIIGDTLSGSGATQQVHILVKPTRADLMTNLIINTNLRTYHMELRSTERTYMAS
VSWRYPQDQLIALRRQNAQAEASSPVATGVDLANINFRYAIEGDRAPWRPLRAYDDGRQVFIEFPRGIGQ
GEMPPLFVVGPEGNTSELVNYRVRANYMIVDRLFAAAELRFGAGDRQKRVRIVRTDGRPTS
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c829606-828581 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGAAGCCGTCTTTCCGTAAAGCCGGAAACCCGGCTTCTCGCACTTCCACATTTACGATTCTCTTGCTGT
GCACGTCGGCGCTCGCCGGCTGCGCCACGGCGAACAGGCCGCCAGAGATCTCCTATGATGACGCCGTGCC
AGCGGCGCTGAGCGCCAATCCTCCGGCTCCCGTGCGCGTGGTCGAGCTGCCGCGACCTCTGCCACTCCCC
GGTCAGATGAAGCCCGTCGAGCCGTCCCGCGGCACACCGGAGCCTACCGATCCGACAGCGCGCGTTAATC
AGGCCAACGCAGCCGCGCGCGTGCAGCCGGTCCGCGATGGCTTCATCAACGCCATGCAAGTGTATCCCTA
TACGGGCGGCGCGCTCTATCAGGTCTACACCGCCGTAGGCCAGATCACTGACATCGCTCTTCAGCCGGGC
GAGCAACTGGTCGGCTCCGGCCCGGTCGCCGCCGGCGACACGGTTCGCTGGATCATCGGCGACACGTTGA
GCGGCTCGGGCGCGACCCAGCAAGTTCATATCCTGGTGAAACCGACCCGCGCCGACTTGATGACGAATCT
CATCATCAACACCAATCTGCGCACCTACCACATGGAGCTGCGCTCGACCGAGCGCACCTATATGGCGTCG
GTGTCCTGGCGGTATCCGCAGGATCAGCTTATCGCGCTGCGGCGCCAAAACGCGCAGGCCGAGGCCAGCA
GTCCCGTCGCCACCGGCGTTGACCTCGCCAACATCAATTTCCGCTACGCCATCGAGGGTGACCGTGCGCC
GTGGCGACCGCTGCGCGCCTACGATGATGGTCGCCAGGTCTTCATCGAGTTTCCGCGCGGCATCGGTCAG
GGCGAAATGCCGCCGCTGTTCGTCGTCGGTCCGGAGGGCAACACCTCCGAACTCGTGAACTACCGCGTCC
GCGCCAACTACATGATCGTCGACCGGCTGTTCGCAGCCGCCGAGCTGCGTTTCGGCGCCGGCGACCGCCA
GAAGCGCGTCCGCATCGTTCGCACTGACGGGAGGCCGACGTCGTGA
 Primer design