SecReT4
Protein ID: 154244694
T4SS name [ID]Trb [274]
Gene symbol-
Locus tagXaut_0743
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]830286..831638 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7IDA2
KEGG IDxau:Xaut_0743
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-53, Aligned region: 37..262
Protein Sequence: 450 a.a.     [Download]
>gi|154244694|ref|YP_001415652.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MGGTGVIDQFLEVFTRYIDGGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIMARLVKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLKASGTGFTVEDLMRPGRVAQTGLDAGRPLLDSISNLMGWIAFFENFI
QIACLLFAWALVLLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKSEFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSQFTAGFANQTPTIDQAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLA
AGGALVAAGAAGGMALRGGAAALSGTAAAARGGAALAGGASTAYSLGAAGQSGASAVGFGLGGVARAAGA
AAGSPLRRAAFRAADGMKSSFSDGAKSAFAATGGTSTMGSIGGTASEAAPSQAADGPPAWARRMKRSQAL
SHGVTAAAQAVRSGDSHGGGSSINLSGGDR
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c831638-830286 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGACCAATTCCTCGAGGTCTTCACCCGCTATATCGACGGCGGCTTCGGCC
TGCTCGGCGGCGAGGTGGCGTTCATCGCCACCACGCTGATCGTCATCGACGTGACGTTGGCCGCTTTGTT
TTGGAGCTGGGGCGCCGACGACGACATCATGGCGCGCCTAGTCAAGAAGACCCTGTTCGTCGGCGTCTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCGCGCATCGTGTTCGAGAGCTTCGCGGGGCTCGGCCTGA
AGGCGTCAGGCACGGGTTTCACCGTCGAAGATCTCATGCGCCCCGGCCGCGTCGCGCAGACCGGCCTCGA
TGCCGGCCGACCGCTGCTCGATTCGATCTCCAACCTGATGGGCTGGATCGCCTTCTTCGAGAACTTCATC
CAGATCGCCTGCCTGCTGTTCGCCTGGGCCCTGGTGCTCCTCGCCTTCTTCATTCTCGCCGTCCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACGACGCTGGCGGGCTTCGTGCTGATCCCCTTCGGCCTCTTTGG
CAAATCCGAGTTCATGGCCGAACGCGTCCTCGGCAACGTCATCTCGAGCGGCATCAAGGTTCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACGTTGTTCTCTCAGTTCACCGCCGGCTTCGCGAACCAGACACCGA
CGATCGACCAGGCGATGGCGATCGTGCTTGCCGCGCTCTCGCTGCTGGGCCTCGGAATCTTCGGCCCCGG
CATCGCCAACGGCCTTGTCTCCGGCGGTCCGCAGCTCGGCGCCGGTGCGGCGGTCGGAACCGGGCTCGCG
GCGGGCGGCGCTCTGGTCGCGGCCGGCGCGGCTGGCGGAATGGCCCTGCGCGGCGGTGCCGCTGCTCTTT
CCGGAACTGCCGCTGCCGCTCGAGGGGGGGCGGCCCTGGCCGGTGGCGCCTCGACGGCCTACAGCCTCGG
TGCCGCCGGCCAGTCGGGCGCGTCCGCCGTCGGGTTCGGACTCGGTGGCGTTGCTCGCGCCGCTGGCGCG
GCCGCCGGCTCACCGCTGCGTCGCGCGGCCTTCCGGGCGGCAGACGGCATGAAGTCGAGCTTCTCCGATG
GCGCCAAGTCCGCGTTCGCGGCTACCGGCGGCACATCGACCATGGGTTCGATCGGCGGCACGGCGTCCGA
GGCTGCGCCATCGCAGGCTGCTGACGGACCGCCGGCCTGGGCCCGCCGCATGAAGCGCTCTCAAGCCCTG
AGCCACGGTGTGACCGCGGCCGCCCAAGCCGTGCGCAGCGGCGACAGCCACGGCGGCGGCTCTTCCATCA
ATCTCTCCGGAGGCGACCGCTGA
 Primer design