SecReT4
Protein ID: 154244699
T4SS name [ID]Trb [274]
Gene symbol-
Locus tagXaut_0748
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]835440..835772 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7IDA7
KEGG IDxau:Xaut_0748
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.9e-24, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|154244699|ref|YP_001415657.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MIRHALRVRHHIATAVSVTVLSMMLAPAAYASGSSMPWEAPLQSILESIEGPVAKIVAVIIIIITGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c835772-835440 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATCCGCCATGCCCTGCGCGTTCGCCATCATATCGCGACGGCCGTGTCCGTCACTGTCCTCAGCATGA
TGCTGGCGCCGGCCGCCTACGCTTCCGGCTCCTCGATGCCGTGGGAAGCGCCGCTGCAGTCGATCCTCGA
ATCCATCGAGGGACCGGTCGCCAAGATCGTGGCGGTGATCATCATCATTATCACCGGCTTGACGCTCGCC
TTCGGCGATACGAGCGGTGGTTTTCGCAGACTGATCCAGATCGTGTTCGGCCTCTCGATCGCCTTCGCGG
CCAGCTCGTTCTTCCTCTCCTTCTTCTCCTTCGGCGGCGGAGCGCTCGTCTGA
 Primer design