SecReT4
Protein ID: 154246817
T4SS name [ID]Trb [275]
Gene symbol-
Locus tagXaut_2879
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3204901..3205233 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7IJC5
KEGG IDxau:Xaut_2879
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-23, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|154246817|ref|YP_001417775.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MIRHALRARRHIATAASVAVFSMMLAPAAHASGSSMPWEAPLQSILESIEGPVAKIIAVMIIIITGLTLA
FGDTSGGARKLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:3204901-3205233 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATCCGCCATGCCCTGCGCGCTCGCCGTCATATCGCGACGGCCGCGTCCGTCGCCGTCTTCAGCATGA
TGCTTGCGCCAGCAGCCCATGCTTCCGGCTCTTCGATGCCGTGGGAAGCGCCGCTGCAATCGATCCTCGA
ATCCATCGAGGGGCCTGTGGCCAAGATCATCGCTGTGATGATCATCATCATCACAGGGCTAACGCTAGCC
TTCGGCGATACGTCAGGCGGCGCGCGGAAGCTGATCCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCCG
CGTCGAGCTTCTTCCTGTCCTTCTTCTCCTTCGGCGGCGGAGCGCTCGTCTGA
 Primer design