SecReT4
Protein ID: 154246822
T4SS name [ID]Trb [275]
Gene symbol-
Locus tagXaut_2884
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3209035..3210387 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7IJD0
KEGG IDxau:Xaut_2884
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-53, Aligned region: 37..262
Protein Sequence: 450 a.a.     [Download]
>gi|154246822|ref|YP_001417780.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MGGTGVIDQFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIMARLVKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLKASGTGFTVDDLMRPGRVAQTGLDAGRPLLDSISNLMGWIAFFENFI
QIACLLFAWALVLLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSQFTAGFAGQTPTIDQAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLA
AGGIVAAGAATVGAVASGGGALAGGAAAAARGGAAMAGGASTAYSLGAAGQSGAAGVASGLGGVARAAGG
AAASPLRRTASRAADSMKSSFSEGAKSAFAATGGTSTMGTIGGSAAEAAPSQAADGPPAWARRMKRSQAL
SHGVTAAAHAVRSGDSHGGGSSINLSEGDR
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|154243958|ref|NC_009720.1|:3209035-3210387 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGACCAGTTCCTCGGCGTATTCACCAGCTACATCGATAGCGGCTTCGGCC
TGCTCGGCGGCGAGGTGGCGTTCATCGCAACCACGCTGATCGTCATCGACGTGACATTGGCCGCGCTGTT
CTGGAGCTGGGGCGCCGACGACGACATCATGGCGCGCCTGGTCAAGAAGACGCTGTTCGTCGGCGTCTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCGCGCATCGTGTTCGAAAGCTTCGCCGGGCTCGGCCTGA
AGGCGTCGGGCACGGGATTTACCGTCGACGATCTCATGCGTCCCGGCCGTGTTGCGCAGACCGGCCTCGA
CGCCGGCCGGCCGCTGCTCGATTCCATCTCCAACCTGATGGGCTGGATCGCCTTCTTCGAGAACTTCATC
CAGATCGCCTGTCTGTTGTTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCATTCTCGCCGTCCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACGACGCTCGCCGGCTTCGTGCTGATCCCGTTCGGCCTGTTCGG
CAAATCCGCGTTCATGGCCGAGCGCGTCCTCGGCAACGTCATCTCGAGCGGCATCAAGGTGCTGGTCCTC
GCCGTCATCATCGGCATCGGCTCGACGTTGTTCTCTCAATTCACCGCCGGGTTCGCTGGCCAGACGCCCA
CGATCGACCAGGCCATGGCGATCGTGCTCGCCGCACTGTCGCTGCTGGGTCTCGGCATCTTCGGTCCCGG
TATCGCCAACGGCCTCGTCTCGGGTGGTCCGCAGCTCGGCGCCGGCGCCGCGGTCGGCACCGGACTCGCG
GCGGGCGGCATAGTGGCGGCGGGCGCTGCGACTGTTGGGGCCGTGGCATCTGGCGGCGGCGCCCTTGCTG
GAGGAGCCGCCGCCGCCGCCCGTGGCGGTGCGGCGATGGCGGGCGGCGCTTCGACCGCTTACAGCCTTGG
CGCCGCTGGCCAGTCGGGCGCCGCAGGCGTGGCGTCAGGCTTGGGCGGGGTCGCACGCGCAGCCGGCGGC
GCGGCGGCTTCGCCCCTCCGCCGGACGGCCTCGCGCGCCGCCGATAGCATGAAGTCGAGCTTCTCCGAAG
GCGCCAAGTCCGCGTTCGCCGCCACCGGCGGCACATCGACCATGGGTACGATCGGCGGAAGCGCGGCCGA
GGCTGCGCCATCGCAGGCTGCTGACGGGCCGCCGGCCTGGGCCCGCCGCATGAAGCGTTCTCAAGCCCTG
AGCCACGGTGTGACCGCGGCCGCCCATGCCGTGCGCAGCGGCGACAGCCATGGCGGCGGCTCTTCCATCA
ATCTCTCCGAAGGCGATCGCTGA
 Primer design