SecReT4
Protein ID: 154246824
T4SS name [ID]Trb [275]
Gene symbol-
Locus tagXaut_2886
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3211067..3212092 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7IJD2
KEGG IDxau:Xaut_2886
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-71, Aligned region: 110..334
Protein Sequence: 341 a.a.     [Download]
>gi|154246824|ref|YP_001417782.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MKPSFRKAGNPASRTSTFAILLLCTSALAGCATANRPPEISYDDAVPAALSANPPAPVRVVELPRPLPLP
GQMKPVEPSRGTPEPTDPTARVNQANAAARVQPVRDGFINAMQVYPYTGGALYQVYTAVGQITDIALQPG
EQLVGSGPVAAGDTVRWIIGDTLSGAGATSQVHILVKPTRADLMTNLIINTNLRTYHMELRSTERTYMAS
VSWQYPQDQLIALRRQNAQAEAARPVATGVDLANINFRYAIEGDRAPWRPLRAYDDGRQVFIEFPRGIGQ
GEMPPLFVVGPEGNTSELVNYRVRANYMIVDRLFAAAELRFGAGDRQKRVRIVRTDGRPAS
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|154243958|ref|NC_009720.1|:3211067-3212092 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGAAGCCGTCTTTCCGTAAAGCCGGAAACCCGGCTTCTCGCACTTCCACATTTGCGATTCTGCTGCTGT
GCACGTCGGCCCTCGCCGGCTGCGCCACGGCGAACAGGCCGCCGGAGATCTCCTACGATGACGCAGTGCC
GGCGGCGCTGAGCGCCAATCCCCCGGCTCCCGTGCGCGTGGTCGAGCTGCCGAGACCTCTGCCGCTCCCT
GGTCAGATGAAGCCCGTCGAGCCATCCCGCGGCACACCCGAACCCACCGATCCGACAGCGCGCGTCAATC
AGGCCAACGCCGCCGCGCGCGTGCAGCCGGTCCGCGACGGCTTCATCAACGCCATGCAGGTCTATCCCTA
TACGGGCGGCGCGCTCTATCAGGTCTATACCGCCGTCGGCCAGATCACCGACATAGCCCTTCAGCCGGGC
GAGCAACTGGTCGGCTCCGGTCCAGTCGCCGCCGGCGACACGGTTCGCTGGATCATCGGCGATACGCTGA
GCGGCGCGGGCGCGACGAGCCAAGTCCACATCCTGGTGAAGCCCACCCGCGCCGACCTGATGACGAATCT
CATCATCAACACGAACTTGCGCACCTACCACATGGAACTTCGCTCGACCGAGCGCACCTATATGGCTTCG
GTGTCCTGGCAGTATCCGCAGGATCAGCTCATCGCGCTGCGGCGCCAGAACGCGCAGGCAGAGGCCGCTA
GGCCAGTCGCCACCGGCGTCGACCTCGCCAACATCAATTTCCGCTATGCGATCGAAGGCGACCGCGCACC
TTGGCGACCGCTGCGCGCCTACGATGATGGTCGCCAGGTCTTCATCGAGTTTCCCCGCGGCATCGGCCAG
GGCGAAATGCCGCCGCTGTTCGTAGTGGGTCCGGAAGGCAACACCTCCGAACTCGTGAACTACCGCGTTC
GCGCAAACTACATGATCGTCGACCGCCTGTTCGCGGCCGCCGAGCTGCGCTTCGGCGCAGGCGACCGCCA
GAAACGCGTCCGGATCGTCCGCACCGATGGGAGGCCCGCGTCGTGA
 Primer design