SecReT4
Protein ID: 154246925
T4SS name [ID]Trb [276]
Gene symbol-
Locus tagXaut_2996
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3334460..3335503 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7IJN3
KEGG IDxau:Xaut_2996
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-69, Aligned region: 116..340
Protein Sequence: 347 a.a.     [Download]
>gi|154246925|ref|YP_001417883.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MTPALHKAAPWSAGRPAFRKSGLPLLLLCTSALSGCATNTPPPEIAYDNAIPAVQATEPPRPVQVVELPR
PLPLPGQLKPVGKDGKPVPEAADPTVRVNQANAAARVQPVRDGFINSMQVYPFVDGALYQVYASPGQITD
IALQPGEQFVGVGPVAAGDTVRWIIGDTESGTGAGKQIHILVKPTRPDLLTNLIINTDRRTYHMELRSTP
STYMASVSWQYPQDQLIALRRQNADAQAAQPVSNGIDLSRVNFRYEVSGDRAPWRPLRAFDDGKQVFIEF
PRGIGQGEMPPLFVVGPEGNTSELVNYRVRGNYMIVDRLFAAAELRFGAGKNQKRVRISRTDGRPAS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c3335503-3334460 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACGCCAGCACTCCACAAAGCCGCCCCCTGGAGTGCAGGGCGTCCGGCTTTCCGTAAATCCGGCTTGC
CGCTTCTGCTGCTCTGCACGTCTGCGCTCTCCGGTTGCGCCACCAACACACCGCCCCCGGAAATCGCCTA
TGACAACGCCATCCCCGCCGTACAGGCGACCGAGCCGCCCAGGCCCGTACAGGTGGTGGAGCTGCCCAGG
CCCTTGCCACTTCCCGGCCAGTTGAAACCGGTCGGTAAGGACGGCAAGCCCGTCCCCGAAGCTGCCGATC
CGACCGTGCGCGTCAACCAGGCCAACGCCGCCGCGCGTGTTCAGCCCGTCCGCGATGGCTTCATCAACTC
GATGCAGGTCTATCCCTTCGTCGATGGCGCGCTTTATCAGGTCTATGCCTCACCGGGGCAGATCACCGAC
ATCGCGCTCCAGCCCGGCGAGCAGTTCGTCGGCGTCGGCCCCGTCGCCGCCGGCGATACGGTGCGCTGGA
TCATCGGAGATACCGAGAGTGGCACGGGGGCGGGCAAACAAATCCACATCCTCGTCAAGCCGACGCGGCC
CGATCTGCTGACCAATCTCATCATCAACACCGACCGTCGCACCTACCACATGGAACTGCGCTCGACGCCT
TCGACCTATATGGCCTCGGTTTCCTGGCAATATCCGCAGGACCAGCTCATCGCGCTCCGGCGGCAGAATG
CCGACGCGCAGGCCGCGCAGCCGGTTTCCAACGGCATCGACCTGTCGCGCGTCAACTTCCGCTATGAGGT
GTCAGGCGACCGTGCGCCTTGGCGGCCGCTGCGCGCTTTCGACGATGGCAAGCAGGTCTTTATCGAGTTC
CCGCGCGGCATCGGCCAGGGCGAGATGCCACCACTGTTCGTGGTCGGGCCGGAGGGCAACACGTCCGAGC
TGGTGAACTACCGCGTGCGCGGCAACTACATGATCGTGGACCGACTGTTCGCCGCCGCCGAGCTGCGCTT
CGGCGCAGGTAAGAACCAGAAGCGCGTGCGTATCTCCCGCACCGATGGGAGGCCGGCATCGTGA
 Primer design