SecReT4
Protein ID: 154246927
T4SS name [ID]Trb [276]
Gene symbol-
Locus tagXaut_2998
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3336186..3337541 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7IJN5
KEGG IDxau:Xaut_2998
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-53, Aligned region: 37..262
Protein Sequence: 451 a.a.     [Download]
>gi|154246927|ref|YP_001417885.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MGGTGVIDHFLEVFTRYIDGGFGLLQPEVGFIATTLIVIDVTLAALFWSWGADENIIARLVKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLKASGTSFTVTDLLRPGKVAQTGLDAGRPLLDSISSLMGYWSFFENFI
QIVCMLFAWVLVLLAFFVLAIQLFITLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSEFTAGFGGATPSIDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAIGTGLA
AGGAVAAGAAAVGAVASGGTALAGGAAAAARGGAALAGGASTAYSLGAAGESGAAAVASGLGNVASAGAQ
AAASPLKRAAGRAADSLKQSYRSGARTAFSATGGSSTAGTVGGEAEGASSTSSSSADGPPAWAKRMKRSQ
QMTHGVQAAAHAVRGGDSHGGGSSVNLSESD
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c3337541-3336186 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGGGCGGCACCGGCGTCATCGACCATTTCCTCGAGGTCTTCACCCGCTACATCGACGGCGGCTTCGGCC
TCCTGCAACCGGAAGTCGGCTTCATCGCCACAACGCTGATCGTCATCGACGTGACGCTCGCCGCCCTATT
CTGGAGCTGGGGCGCGGATGAGAACATCATCGCCCGGCTGGTGAAGAAGACGCTGTTCGTCGGTGTCTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCCCGCATCGTCTTCGAGAGCTTCGCCGGCCTGGGCCTGA
AGGCGTCCGGCACGAGCTTCACCGTCACCGACCTGCTGCGCCCCGGAAAGGTGGCGCAGACCGGCCTCGA
CGCCGGACGACCGCTGCTCGACTCCATCTCCAGCCTGATGGGCTACTGGTCGTTCTTCGAGAACTTCATC
CAGATCGTCTGCATGTTGTTCGCCTGGGTGCTGGTGCTGCTCGCCTTCTTCGTTCTCGCCATCCAGCTCT
TCATCACCCTGATCGAGTTCAAGCTGACAACGCTCGCCGGCTTCGTGCTGATCCCCTTTGGCCTGTTCGG
TAAATCCGCCTTCATGGCCGAACGGGTGCTCGGCAATGTAATTTCGTCGGGCATCAAGGTGCTGGTGCTC
GCCGTTATTATCGGCATCGGTTCGACCCTGTTCTCCGAGTTCACCGCGGGCTTCGGCGGCGCCACGCCGT
CGATCGACGATGCGATGGCGATCGTGCTCGCCGCCCTGTCGCTGCTTGGCCTCGGTATCTTCGGTCCCGG
TATCGCCAATGGCCTCGTCTCCGGCGGGCCGCAGCTCGGCGCTGGCGCGGCGATCGGCACCGGCCTGGCC
GCAGGCGGCGCGGTCGCGGCCGGCGCTGCCGCAGTGGGCGCCGTCGCTTCCGGCGGCACAGCCCTGGCCG
GTGGCGCGGCCGCCGCTGCTCGTGGTGGAGCCGCATTGGCTGGCGGCGCATCGACCGCCTACAGCCTTGG
CGCAGCCGGGGAATCCGGCGCCGCCGCCGTCGCCTCCGGCCTCGGCAATGTCGCCAGCGCCGGCGCGCAA
GCCGCCGCCTCCCCGCTCAAACGCGCGGCTGGCCGCGCCGCTGACAGCCTGAAGCAGAGCTACCGATCCG
GCGCGCGCACCGCCTTCAGCGCAACCGGCGGGTCATCGACCGCCGGGACCGTCGGCGGCGAGGCCGAAGG
TGCGTCCTCGACCTCATCTTCCTCCGCAGACGGGCCGCCGGCCTGGGCCAAGCGCATGAAGCGCTCGCAG
CAGATGACACACGGCGTCCAGGCCGCCGCTCACGCCGTTCGCGGCGGCGATAGCCACGGCGGCGGCTCTT
CCGTCAACCTTTCCGAAAGCGACTGA
 Primer design