SecReT4
Protein ID: 154246932
T4SS name [ID]Trb [276]
Gene symbol-
Locus tagXaut_3003
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]3341405..3341737 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7IJP0
KEGG IDxau:Xaut_3003
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.1e-26, Aligned region: 6..100
Protein Sequence: 110 a.a.     [Download]
>gi|154246932|ref|YP_001417890.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MIQRLHQTRHRLVSALSVATLSVVMAAPAHASGSSMPWEAPLQSILQSIEGPVAKIVAVIIIITTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c3341737-3341405 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGATCCAACGCCTGCATCAAACGCGCCATCGCCTCGTCTCGGCGCTGTCCGTCGCCACGCTCTCCGTCG
TGATGGCGGCGCCCGCCCATGCCTCCGGTTCATCCATGCCGTGGGAAGCACCGCTGCAATCCATCCTTCA
GTCGATCGAAGGGCCGGTGGCCAAGATCGTCGCCGTCATCATCATTATCACGACCGGACTGACGTTGGCC
TTCGGCGACACCTCCGGGGGGTTCCGTCGCCTGATCCAGATCGTCTTCGGCCTGTCGATCGCCTTTGCGG
CGTCGAGCTTCTTTCTGTCGTTCTTCTCGTTCGGCGGCGGGGCGCTCGTCTGA
 Primer design