SecReT4
Protein ID: 154247913
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3991
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4419880..4421124 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA7IMH1
KEGG IDxau:Xaut_3991
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.9e-62, Aligned region: 231..409
Protein Sequence: 414 a.a.     [Download]
>gi|154247913|ref|YP_001418871.1| conjugation TrbI family protein [Xanthobacter autotrophicus Py2]
MSGIEPGKETGPELSGDDGARPLTGETVSAMRLRPEPPRVTRLSRKVLAGLGLVAGLGIGGALIYALQAR
KDHGHGQELYATDVKATPDGLAGLPKDYTGIPKLGPPLPGDLGRPILNAQTAVQPTVPTMGGMPNPALSP
EEQRQQRESEDARTGRLFAQTNTRSASPAVTQQAGVTSASAAPAADLTSLGLAPQAATPTAQERQLAFLS
QAVDRRTVSPDRVAAPASANILQAGAVIPAALITGIRSDLPGQITAQVTENVHDSPTGRILLIPQGTRII
GQYDNGVGFGQRRVLLVWNRLIFPNGRSIVLERQTGADAEGYAGLEDGIDYHWGELFKAAVLSTILSVGA
SAGTSGSDSDLVSALREGASDSISQTGRQLVQRQLNIAPTLTIRPGFPVRIIVTRDLVLESYGG
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4421124-4419880 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGAGCGGCATCGAACCCGGGAAGGAGACAGGGCCGGAGCTGAGCGGTGATGACGGCGCTCGGCCACTGA
CGGGGGAGACTGTGTCGGCCATGCGGCTGCGGCCGGAACCGCCGCGGGTGACCCGCCTGTCCCGAAAGGT
ATTAGCCGGGCTGGGGCTCGTTGCCGGCCTTGGGATCGGCGGGGCGCTGATCTACGCCCTGCAAGCGCGA
AAGGACCACGGACACGGCCAGGAACTCTACGCCACCGACGTCAAGGCGACGCCGGACGGGCTCGCCGGCC
TACCCAAGGATTACACCGGCATCCCCAAGCTCGGGCCTCCGCTGCCCGGCGACCTCGGCCGGCCGATCCT
CAATGCGCAGACGGCAGTGCAGCCGACGGTGCCGACAATGGGAGGCATGCCAAATCCCGCCTTGAGCCCC
GAGGAGCAACGCCAGCAGCGGGAAAGCGAAGACGCCCGGACCGGACGGCTGTTCGCTCAGACCAATACCC
GGTCGGCAAGCCCGGCGGTGACCCAGCAGGCGGGAGTCACTTCAGCGTCAGCGGCGCCGGCCGCCGATCT
CACCAGCCTCGGCCTTGCGCCGCAGGCGGCGACGCCGACGGCCCAGGAGCGCCAGCTTGCCTTCCTGAGC
CAGGCCGTGGACCGGCGCACCGTGTCGCCCGACCGCGTGGCGGCTCCTGCCTCCGCCAACATCCTGCAGG
CCGGCGCCGTCATCCCCGCGGCGCTGATCACCGGCATCCGCTCGGACCTGCCGGGCCAGATCACCGCCCA
GGTGACCGAGAATGTCCACGATAGCCCGACCGGGCGGATCCTCCTGATCCCCCAGGGCACACGCATCATT
GGCCAGTATGACAATGGCGTCGGCTTCGGGCAGCGCCGGGTGCTCCTCGTCTGGAACCGCCTGATCTTCC
CCAATGGCCGGTCCATCGTGCTGGAGCGCCAGACCGGAGCCGACGCGGAAGGCTACGCTGGCCTTGAGGA
TGGCATCGACTACCATTGGGGCGAGCTGTTCAAGGCGGCGGTGCTCTCGACCATCCTCAGCGTCGGGGCG
AGCGCAGGAACGTCCGGCAGCGATAGCGACCTCGTGAGTGCTTTGCGGGAAGGCGCATCCGACAGCATCA
GCCAGACCGGCCGGCAGCTCGTCCAGCGCCAGCTCAACATTGCGCCGACCCTCACGATCCGGCCGGGATT
CCCGGTGCGGATCATCGTCACGCGCGACCTCGTTCTTGAATCCTATGGAGGTTGA
 Primer design