SecReT4
Protein ID: 154247914
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3992
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4421121..4422173 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7IMH2
KEGG IDxau:Xaut_3992
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-70, Aligned region: 119..343
Protein Sequence: 350 a.a.     [Download]
>gi|154247914|ref|YP_001418872.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MMPAIRTSGRPAFRVLSFPSFRKSGLPLLLLCTSALAGCATFEKPPEIEYDDAPPAVFKAEPPGPVRIVE
LPKPLPLPGQLKPVGKDGKAEPESADPTARVNQANAAARVQPVRNGFINSMQVYPFVDGALYQVYASPGQ
ITDVALQPGEQLVGTGPVAAGDTVRWIIGDTESGAGGAKQVHILVKPTRPDLTTNLVINTNLRTYHMELR
STEKTYMASVSWQYPQDQLIALRRQNAEAQAVQPVATGIDLAKVNFRYEVSGDRAPWRPLRAFDDGQQVF
IEFPRGIAHGEMPPLFVVGPQGDTSELVNYRVRGTYMIVDRLFAAAELRFGADKDQKRVRISRTDGRPVL
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4422173-4421121 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATGCCTGCCATCCGCACATCCGGGAGGCCGGCTTTCCGCGTCCTCTCCTTTCCGTCTTTCCGGAAGT
CCGGCTTGCCACTTCTCCTGCTTTGCACATCGGCCCTGGCGGGCTGCGCCACCTTCGAGAAGCCCCCGGA
GATCGAATATGACGATGCCCCGCCCGCCGTCTTCAAGGCTGAGCCGCCGGGGCCGGTGCGCATCGTTGAG
CTGCCGAAGCCCTTGCCGCTGCCCGGCCAGCTGAAGCCGGTGGGCAAGGACGGCAAGGCCGAGCCCGAGT
CCGCGGACCCGACGGCCCGAGTGAACCAGGCCAATGCTGCCGCGCGCGTTCAGCCGGTGCGCAACGGCTT
CATCAACTCCATGCAGGTCTATCCCTTCGTGGATGGCGCGCTCTATCAGGTCTACGCTTCGCCCGGTCAG
ATCACCGACGTCGCCCTGCAACCCGGCGAGCAACTGGTGGGCACGGGGCCGGTCGCTGCCGGCGACACGG
TGCGCTGGATCATCGGCGACACCGAGAGCGGGGCGGGCGGGGCAAAGCAAGTCCACATCCTGGTGAAACC
GACACGGCCGGACCTCACCACCAACCTCGTCATCAACACCAATTTGCGCACCTACCACATGGAGCTGCGC
TCCACCGAGAAGACCTACATGGCCTCGGTCTCCTGGCAATATCCCCAAGACCAGCTCATCGCCCTCAGGC
GCCAGAACGCGGAAGCGCAGGCGGTGCAGCCCGTCGCCACGGGCATCGACCTGGCAAAGGTGAACTTCCG
CTACGAGGTGAGCGGCGACCGGGCACCGTGGCGGCCGCTGCGCGCCTTCGATGATGGGCAGCAGGTCTTC
ATCGAGTTTCCCCGCGGGATCGCCCATGGCGAGATGCCGCCGCTGTTCGTGGTCGGGCCGCAAGGCGACA
CCTCCGAACTCGTGAACTATCGCGTGCGCGGCACCTATATGATCGTGGACCGGCTCTTCGCAGCCGCCGA
GCTGCGCTTCGGCGCCGACAAGGACCAGAAGCGCGTGCGCATCTCCCGCACCGACGGGAGGCCGGTCCTA
TGA
 Primer design