SecReT4
Protein ID: 154247915
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3993
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4422170..4422859 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA7IMH3
KEGG IDxau:Xaut_3993
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-60, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|154247915|ref|YP_001418873.1| conjugal transfer protein TrbF [Xanthobacter autotrophicus Py2]
MTPFKRPSVHYGRSPEPETPYQRAAQVWDDRIGSARVQAKNWRLMAFGCLALSAGLSCALAWQALSGSVV
PWVVQVDKLGQAQAVAPAASDYRPSDPQIAFHLARFIEEVRSISADPVIVRQNWLRAYAYTTLAGAIALN
DYARANDPFARVGKQQVAVEVSSVIRASPDSFRIAWTERRFQDGSLADTSRWSAILTVAVQAPRDADRLR
ANPLGIYVNAINWSKELAQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4422859-4422170 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACCCCCTTCAAGCGCCCGTCGGTCCATTACGGCCGCTCCCCCGAGCCTGAGACGCCGTATCAGCGCG
CGGCCCAGGTCTGGGATGACCGCATCGGCTCGGCCCGGGTCCAGGCGAAGAACTGGCGCCTCATGGCCTT
CGGCTGCCTCGCCCTGTCGGCCGGCCTCTCCTGCGCCCTGGCGTGGCAGGCCCTGAGCGGCTCGGTGGTT
CCGTGGGTGGTTCAGGTGGACAAGCTCGGTCAGGCGCAGGCGGTCGCGCCGGCCGCCTCGGACTATCGCC
CCTCCGATCCCCAGATCGCCTTCCACCTCGCCCGCTTCATTGAAGAGGTCCGCAGCATCTCTGCCGATCC
CGTGATCGTCCGCCAGAACTGGCTCAGGGCCTACGCCTACACGACCCTGGCCGGAGCAATCGCCCTCAAC
GACTATGCCCGCGCCAATGATCCTTTCGCCCGGGTCGGCAAGCAGCAGGTGGCGGTGGAGGTCTCCAGCG
TGATCCGGGCCTCGCCGGACTCCTTCCGCATCGCCTGGACCGAGCGCCGCTTCCAGGACGGCAGCCTCGC
CGACACCTCCCGCTGGAGCGCCATCCTCACCGTCGCGGTGCAGGCGCCGCGGGATGCGGATCGGCTCCGG
GCCAATCCGCTGGGGATCTACGTCAACGCCATCAACTGGTCGAAGGAACTCGCACAATGA
 Primer design