SecReT4
Protein ID: 154247916
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3994
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4422856..4424145 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7IMH4
KEGG IDxau:Xaut_3994
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.7e-51, Aligned region: 37..262
Protein Sequence: 429 a.a.     [Download]
>gi|154247916|ref|YP_001418874.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MNDVGVIDTFLNTFTSYIDSGFGLIKGEVTGLSSILIALDITLAGLFWAWGADEDVMRRLVRKTLAIGFF
AWIIGNFNSLSKIVFESFAGLGLKAGGSAISTAEFLRPGRLAEVGLTAAQPLLDAASQLAGPVAIFVNAV
QIAVLLVSWLLILIAFFILAVQLFVTLIEFKLTTLAGFVLIPFAFFGKTAFLAEKVLGNIVASGVKVMVL
AVIIGIGSGLFSQFTTSYGDAQPTISQALAAVLAALALLGLGIFGPGIATGLITGAPQLGAGAAVGTGLA
AGGMALAGAGAAGLAVRGAGAVFSGAAAAARAGASLAGGAASAYSAGAAGQSGLSGVGSGLGGVARAAGA
AATSPLQRSADTSGEAAASSSGPAPSSNPASSGDAPDWARRMRRSQQVAHGIQTATHAVRSGDSHGGGSS
ISLSESDRP
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4424145-4422856 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGAACGACGTGGGCGTCATCGACACCTTCCTCAACACCTTCACCAGCTACATCGATTCCGGCTTCGGCC
TGATCAAGGGCGAGGTGACGGGCCTCTCCTCCATCCTGATCGCACTCGACATCACGCTCGCCGGCCTGTT
CTGGGCCTGGGGCGCCGACGAGGACGTGATGCGCCGGCTGGTGCGCAAAACCCTCGCCATCGGCTTCTTC
GCCTGGATCATCGGCAACTTCAACTCGCTCTCGAAGATCGTGTTCGAGAGCTTCGCCGGGCTCGGCCTCA
AGGCCGGCGGCTCCGCCATCAGCACGGCGGAATTCCTGCGGCCGGGGCGACTTGCGGAAGTGGGGCTCAC
CGCCGCCCAGCCGCTGCTCGACGCCGCAAGCCAGCTCGCCGGGCCGGTGGCGATCTTCGTCAATGCCGTG
CAGATCGCCGTGCTGCTGGTCTCCTGGCTGCTGATCCTGATCGCCTTCTTCATCCTGGCGGTGCAGCTCT
TCGTCACCCTCATCGAGTTCAAGCTGACGACGCTCGCCGGCTTTGTGCTCATCCCCTTCGCTTTCTTCGG
CAAGACCGCGTTCCTCGCCGAGAAGGTGCTCGGCAACATCGTGGCGTCGGGCGTGAAGGTGATGGTGCTC
GCTGTCATCATCGGCATCGGCTCGGGGCTCTTCTCCCAGTTCACCACCTCCTACGGCGATGCCCAGCCCA
CCATCAGCCAGGCGCTAGCCGCGGTGCTGGCCGCGCTCGCGCTCCTCGGGCTCGGCATCTTCGGGCCGGG
AATCGCCACGGGACTGATCACGGGCGCGCCGCAGCTCGGCGCCGGAGCCGCCGTGGGTACGGGCCTTGCC
GCCGGCGGCATGGCACTCGCCGGAGCCGGCGCCGCGGGCCTTGCCGTGCGTGGAGCCGGTGCCGTGTTCT
CGGGAGCCGCCGCTGCGGCGCGTGCGGGCGCGAGCCTCGCCGGGGGTGCTGCATCCGCCTACAGCGCGGG
AGCCGCTGGCCAGTCCGGCCTTTCCGGTGTCGGGAGCGGTTTGGGTGGCGTGGCGAGAGCAGCCGGCGCG
GCCGCGACATCTCCCTTGCAGCGCTCGGCCGACACATCAGGCGAAGCGGCGGCCAGCAGCTCCGGCCCAG
CCCCGTCGAGCAACCCGGCCTCCTCCGGCGATGCCCCCGATTGGGCCCGGCGCATGCGCCGCTCCCAGCA
GGTCGCCCACGGCATCCAGACCGCGACCCATGCCGTCCGATCCGGCGACAGCCATGGCGGCGGGTCGTCC
ATCTCCCTCTCCGAAAGCGATCGCCCATGA
 Primer design