SecReT4
Protein ID: 154247918
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3996
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4424415..4425149 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA7IMH6
KEGG IDxau:Xaut_3996
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 7.3e-06, Aligned region: 11..46
Protein Sequence: 244 a.a.     [Download]
>gi|154247918|ref|YP_001418876.1| conjugal transfer protein TrbJ [Xanthobacter autotrophicus Py2]
MIRLMLRAALVAAPLLMCPLAPAAAQAVVFDPSNYAQNVLQAARALQQVTNQITSLQNEAQMLINQARNL
ASLPYSSLSALQQSAQQTQQLLGQAQKIAYDVGAIDRAFQGQYGSVSLSTSDAALVTQAKTRWETTVAGL
QDALRVQAGVVGNLDIGRTQASTLVGQSQAATGALQAIQAGNQLQALQAQQLSDLTAVVVANGRAQALSE
AERATAVSEGQEHYRRFSTRSSYQSSAVTMFRGN
 
Nucleotide Sequence: 735 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4425149-4424415 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATCCGCCTGATGCTGCGGGCGGCGCTCGTCGCTGCGCCGCTCCTCATGTGCCCTCTCGCGCCGGCCG
CGGCACAGGCCGTGGTCTTTGACCCCTCCAACTATGCCCAGAACGTCCTCCAGGCGGCGCGGGCCTTGCA
GCAGGTCACCAACCAGATCACCTCGCTTCAGAATGAAGCACAGATGCTGATCAACCAGGCCCGCAACCTC
GCAAGCCTGCCGTATTCCTCCCTCAGCGCGCTCCAGCAATCCGCCCAGCAGACCCAGCAGTTGCTCGGGC
AGGCGCAGAAGATCGCTTATGACGTCGGCGCCATCGACCGGGCGTTCCAAGGTCAGTACGGCTCGGTTTC
CCTGAGCACCTCGGACGCTGCTCTTGTCACCCAGGCTAAGACCCGCTGGGAGACCACGGTCGCCGGTCTT
CAGGATGCGCTGCGGGTGCAGGCGGGCGTCGTCGGCAATCTCGACATTGGCCGGACCCAGGCCTCAACAC
TGGTCGGCCAGAGCCAGGCGGCGACCGGCGCGTTGCAGGCCATCCAGGCAGGGAACCAGCTCCAGGCGCT
CCAGGCGCAGCAGCTCTCCGATCTCACCGCGGTGGTGGTCGCCAATGGCCGGGCGCAGGCGCTGTCCGAA
GCTGAGCGTGCCACGGCGGTGTCTGAGGGGCAGGAGCACTACCGGCGCTTCTCCACCCGGTCGAGCTACC
AGTCCTCCGCCGTCACCATGTTCCGCGGCAATTGA
 Primer design