SecReT4
Protein ID: 154247919
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3997
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4425146..4427584 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA7IMH7
KEGG IDxau:Xaut_3997
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.1e-34, Aligned region: 442..722
CagE_TrbE_VirB [PF03135], Evalue: 4.3e-14, Aligned region: 181..388
Protein Sequence: 812 a.a.     [Download]
>gi|154247919|ref|YP_001418877.1| conjugal transfer ATPase TrbE [Xanthobacter autotrophicus Py2]
MMNLAEYRRHASRLADYLPWAALVGSGVVLNKDGSVQRTARFRGPDLDSAVPAELVAAAGRLNSAFRRLG
SGWALFVEAQRHPAGAYPASVFPDPASALVEAERKADFAEAGSHFESSYFLTFTWLPPAEDAARAESWLY
EGRARGGVDPYEALGAFVDRTDRVLRLVEAFMPECRWLDDAETLTYLHGCVSTKRQRVRVPETPMYLDAL
LADQPLTGGLEPMLGSEHLRVLTIVGFPTATTPGILDDLNRLAFPYRWSTRAILLDKTDATRLLTRIRRQ
WFAKRKSIAAILKEVMTNEASVLVDSDAANKAVDADLALQELGADHAGIAYLTATVTVWDADPRIADEKL
RLVEKAIQGRDFTAMVETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGEAQDAHFGGPP
LFYGKTEGATPFRFSLHVGDVGHTLVIGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGGSIRAAALAMG
GDWHDLGGSLSDGSEDSVALQPLSRVDDLAERSWAADWITAILSREGVSIAPEVKEHIWSTLTSLASAPV
EERTLTGLAVLLQSNDLKQALRPYCIGGAHGRLLDAEAEHLGQAFVQAFETEGLIGTTAAPAVLSYLFHR
IEDRLNGSPTLIIIDEGWLALDDQGFAGQLREWLKTLRKKNASVVFATQSLSDIDGSAIAPAIIESCQTR
LLLPNERAVEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGSRLFELGLSQVALALCAAGSKTDQ
AALSLILAEHGRDGFLAAWLRHRGLGWAADLIPTLDLLETRS
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4427584-4425146 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATGAACCTCGCGGAATACCGGCGTCACGCCAGCCGGCTCGCCGACTACCTGCCCTGGGCGGCACTGG
TCGGCTCTGGCGTCGTCCTCAACAAGGATGGCAGCGTCCAGCGGACGGCACGCTTCCGTGGGCCGGACCT
TGATTCCGCGGTGCCGGCCGAACTGGTGGCGGCGGCGGGTCGCCTCAACAGCGCCTTTCGCCGCCTCGGC
TCCGGCTGGGCACTCTTTGTGGAGGCCCAGCGACACCCGGCGGGTGCCTATCCGGCGAGTGTCTTTCCCG
ATCCCGCCTCCGCGCTGGTCGAAGCCGAGCGCAAGGCCGACTTCGCGGAAGCCGGCAGCCATTTCGAATC
CAGCTATTTCCTCACCTTCACCTGGCTGCCGCCGGCGGAGGACGCTGCACGGGCGGAGAGCTGGCTCTAT
GAAGGCCGCGCGCGTGGTGGCGTCGATCCCTATGAGGCGCTCGGCGCCTTCGTCGACCGCACGGACCGAG
TCCTGCGGCTCGTCGAGGCCTTCATGCCCGAGTGCCGCTGGCTCGACGATGCCGAGACCCTCACATATCT
GCACGGTTGCGTCTCGACCAAGCGCCAGCGGGTCCGCGTTCCCGAGACGCCCATGTATCTCGACGCCCTG
CTGGCAGACCAGCCGCTCACCGGCGGGCTCGAGCCGATGCTGGGGTCCGAGCATCTACGCGTCCTCACCA
TCGTCGGCTTCCCGACGGCGACGACGCCGGGGATCCTCGACGACCTCAACCGGCTCGCCTTTCCCTATCG
CTGGTCCACCCGCGCCATTCTCCTCGACAAAACCGACGCCACCCGGCTCCTCACCAGGATCCGCCGGCAG
TGGTTCGCCAAGCGCAAGTCCATCGCCGCCATCCTGAAGGAGGTGATGACCAACGAGGCCTCGGTACTGG
TGGATTCAGATGCCGCCAACAAGGCGGTGGATGCCGACCTCGCTTTGCAGGAGCTCGGCGCCGACCATGC
CGGCATCGCCTATCTTACCGCGACGGTGACCGTCTGGGACGCCGATCCCCGCATCGCTGACGAGAAGCTC
CGGCTGGTGGAGAAGGCAATCCAGGGCCGGGACTTCACGGCCATGGTCGAGACGATCAATGCCGTGGATG
CCTGGCTCGGCAGCTTGCCGGGGCACGTCTACGCCAATGTCCGCCAACCGCCCATTTCCACCCTCAACCT
CGCCCATATGATCCCGCTGTCGGCGGTGTGGGCGGGCGAGGCACAGGACGCGCATTTCGGCGGGCCGCCG
TTGTTCTACGGCAAGACCGAGGGGGCGACCCCGTTCCGTTTTTCCCTCCACGTTGGCGATGTGGGCCACA
CCCTCGTGATCGGGCCGACGGGCGCCGGCAAGTCGGTGCTGCTGGCGCTGATGGCATTGCAGTTCCGGCG
CTACGCTGGATCCCAGGTGTTCGCTTTCGACTTCGGCGGCAGCATCCGGGCGGCCGCCCTCGCCATGGGC
GGCGACTGGCACGACCTCGGCGGGAGCCTGTCCGATGGGAGCGAGGACAGCGTCGCGCTCCAGCCTCTTT
CCCGTGTGGATGATCTCGCCGAACGCTCATGGGCCGCCGACTGGATCACGGCGATCCTCTCCCGCGAGGG
CGTTTCCATCGCCCCGGAGGTGAAGGAGCACATCTGGTCGACCCTCACCTCCCTTGCCTCCGCTCCCGTC
GAGGAACGGACCCTCACCGGCCTCGCCGTCCTGCTCCAGTCCAACGATCTCAAACAGGCGCTACGCCCCT
ATTGTATCGGTGGCGCCCATGGCCGGCTGCTCGATGCCGAGGCGGAGCACCTGGGGCAGGCCTTCGTCCA
GGCCTTCGAGACCGAAGGGCTGATCGGCACCACCGCGGCACCGGCCGTGCTGTCCTATCTGTTCCACCGC
ATCGAGGACCGGCTCAACGGGTCTCCGACCCTCATCATCATCGATGAGGGATGGCTCGCCCTTGATGACC
AGGGCTTTGCCGGCCAGCTCCGCGAGTGGCTTAAGACGCTGCGGAAGAAGAACGCCAGCGTCGTCTTCGC
CACGCAGTCCCTCTCCGACATCGACGGCTCGGCCATCGCCCCGGCCATCATCGAGAGCTGCCAGACGCGG
CTGCTGCTCCCCAACGAGCGGGCCGTCGAGCCCCAGATCACCGCCATCTACCGGCGCTTCGGCCTCAACG
ACCGGCAGATCGAGATCCTCGCACGGGCCACCCCGAAGCGGGACTATTACTGCCAGTCCCGACGCGGCAG
CCGCCTGTTCGAGCTCGGGCTGTCGCAGGTGGCGCTCGCCTTGTGCGCCGCCGGGTCCAAGACCGATCAG
GCTGCGCTCTCGCTGATCCTCGCCGAGCATGGGCGCGATGGTTTCCTCGCCGCCTGGCTACGGCATCGGG
GCCTCGGCTGGGCCGCCGACCTCATCCCCACCCTCGACCTTCTGGAGACACGCTCATGA
 Primer design