SecReT4
Protein ID: 154247921
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_3999
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4427867..4428199 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7IMH9
KEGG IDxau:Xaut_3999
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.7e-25, Aligned region: 10..100
Protein Sequence: 110 a.a.     [Download]
>gi|154247921|ref|YP_001418879.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MTFTLPPFYRRLLQAVAGATACVCVVSAAHASGSSMPWETPLQSILDSIQGPVAKIIAVIVIISTGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4428199-4427867 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGACTTTCACGCTCCCTCCATTCTACCGCCGATTGCTGCAGGCCGTGGCCGGTGCCACCGCCTGCGTGT
GTGTTGTCTCCGCGGCCCACGCCTCCGGCTCCTCCATGCCGTGGGAAACGCCGCTGCAGTCGATCCTGGA
TTCGATCCAGGGGCCAGTCGCCAAGATCATCGCGGTGATCGTCATTATCTCCACCGGCCTCGCGCTCGCC
TTCGGCGACACCTCTGGCGGATTCCGGCGGCTGATCCAGATCGTATTCGGCCTCTCCATCGCCTTCGCCG
CTTCGAGCTTCTTCCTCTCCTTCTTCTCCTTCAGCGGCGGAGCGCTGGTCTGA
 Primer design