SecReT4
Protein ID: 154247922
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_4000
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4428196..4429182 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA7IMI0
KEGG IDxau:Xaut_4000
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-85, Aligned region: 25..290
FtsK_SpoIIIE [PF01580], Evalue: 9e-05, Aligned region: 141..180
Protein Sequence: 328 a.a.     [Download]
>gi|154247922|ref|YP_001418880.1| P-type conjugative transfer ATPase TrbB [Xanthobacter autotrophicus Py2]
MATSPHSSEGLTRGERMLRTALGPMITRLLEDPAVVEVMLNPDGRLWVDRLSEGLRDTGERLAAADGERI
VRLVAHHIGAEVHAGAPRVSAELPGTGERFEGLLPPVVASPTFAIRKPAAAVFTLDDYVAAGIMSAPQAE
ALRHGVASRANILVAGGTSTGKTTLTNALLAEVTKTSERVVLIEDTRELQCAAPNLVAMRTKDGVASLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSAIGALRRLEQLIQEAVVTVPRALIA
ETIDLIAVLSGRGSARRLSELSHVEGLGPDGDYRVIPITAPSEEGTSL
 
Nucleotide Sequence: 987 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4429182-4428196 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGGCGACTTCACCTCACAGTTCGGAAGGCCTGACACGCGGCGAACGCATGTTGCGCACCGCGCTTGGCC
CGATGATCACCCGCCTTCTTGAAGACCCGGCCGTCGTCGAGGTCATGCTCAATCCGGACGGGCGCCTGTG
GGTCGACCGGCTGTCCGAGGGGCTTCGCGATACAGGCGAGCGATTAGCCGCCGCCGATGGCGAACGCATC
GTCCGCCTCGTTGCGCACCATATCGGCGCCGAGGTCCATGCCGGCGCCCCGCGGGTGTCAGCCGAACTGC
CGGGAACGGGAGAGCGGTTCGAAGGCCTGCTCCCGCCCGTCGTGGCCTCCCCGACCTTCGCCATCCGCAA
ACCGGCCGCCGCCGTCTTCACGCTCGACGACTATGTCGCCGCCGGCATCATGTCTGCGCCGCAGGCCGAA
GCCCTGCGCCATGGCGTCGCCTCCCGCGCCAACATCCTGGTCGCCGGCGGCACCTCCACCGGCAAGACCA
CGCTCACCAACGCGCTGCTCGCCGAGGTGACCAAGACCTCCGAACGCGTCGTCCTCATCGAGGACACACG
AGAACTCCAATGCGCAGCCCCCAACCTTGTAGCGATGCGCACCAAGGACGGCGTCGCCTCGCTCTCGGAC
CTCGTCCGCTCATCGCTGCGCCTGCGGCCGGATCGCATCCCCATCGGCGAGGTCCGAGGTGCCGAAGCCC
TTGACCTCCTGAAGGCCTGGGGCACAGGCCACCCTGGGGGCATCGGCACCATCCACGCCGGCAGCGCCAT
CGGGGCCTTGAGGCGTCTCGAGCAACTCATCCAGGAAGCCGTCGTCACCGTACCTCGGGCCCTGATCGCC
GAGACCATCGACCTCATCGCCGTGCTGTCGGGCCGCGGCTCCGCGCGCCGCCTTTCCGAGCTCTCTCACG
TCGAAGGTCTCGGGCCCGACGGCGACTACCGCGTCATCCCCATCACCGCTCCATCCGAAGAAGGAACCTC
CCTGTGA
 Primer design