SecReT4
Protein ID: 154247928
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_4007
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4434900..4436879 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA7IMI6
KEGG IDxau:Xaut_4007
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-101, Aligned region: 111..556
TraG-D_C [PF12696], Evalue: 5.1e-30, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 3.8e-26, Aligned region: 171..536
Protein Sequence: 659 a.a.     [Download]
>gi|154247928|ref|YP_001418886.1| conjugal transfer coupling protein TraG [Xanthobacter autotrophicus Py2]
MSATKILWGQILAVFAIVLATTWGATEYVAWRLGFQDQLGSPWFVLGYWPVYHPPAFFWWWYFYDAYAPE
IFTEGAFIAASGGFLSIAIAIGLSVWRAREAKRVETYGSARWAEPDEIRSAGLLGSDGVVLGRHGGDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNVKSAAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAERDKTLAGVAVFLSDPR
RPIEATLAAMMTTPHLGETGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAKVTRRCDWRI
ADLVAHRQPTTLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKAGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYELKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLSPWLGHLMVSRSETARPLLTPGEVMQLPPADEIVMVAGTPPIRAKKARYYEDARFRERILQPPLLA
EPNEQRADDWTVLPLPAPSQLSLMVQGRDDEDTTGSERRHQPELARVASVEELALPQNEFEIDLADESED
DVARNSRMTRVMQGVARQVSLDPRDGMEL
 
Nucleotide Sequence: 1980 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4436879-4434900 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGTCCGCGACCAAGATCCTCTGGGGCCAGATCCTCGCAGTCTTCGCCATCGTGCTCGCCACCACCTGGG
GGGCGACGGAATATGTCGCCTGGCGGCTGGGCTTCCAGGACCAACTCGGCTCACCCTGGTTCGTGCTGGG
GTACTGGCCCGTCTATCACCCGCCGGCCTTCTTCTGGTGGTGGTATTTCTACGATGCCTATGCGCCGGAG
ATTTTCACAGAAGGCGCCTTCATCGCGGCCTCGGGCGGGTTCCTGTCCATTGCGATCGCCATCGGCCTGT
CGGTCTGGCGGGCCCGGGAGGCGAAGCGGGTCGAGACCTACGGTTCCGCCCGCTGGGCCGAGCCGGACGA
GATCCGTTCAGCCGGTCTTCTCGGATCCGACGGGGTAGTGCTCGGCCGCCATGGAGGGGACTATCTGCGC
CATGACGGGCCCGAGCACGTCCTGTGCTTCGCGCCCACCCGGTCGGGCAAGGGCGTGGGCCTCGTCGTCC
CATCGCTCCTCACCTGGCCAGGCTCTGCCATCGTCCACGACATCAAGGGCGAAAACTGGCAGCTCACCGC
CGGCTTCCGGGCACGGCACGGGCGCGTGTTGCTGTTCGACCCCACCAATGTGAAATCGGCCGCTTACAAT
CCGCTGCTGGAGGTCCGCCGCGGGGAGTGGGAGGTCCGCGACGTCCAGAACATCGCCGATATCCTGGTCG
ACCCTGAGGGCTCACTGGAAAAGCGCAACCACTGGGAAAAGACCAGCCACGCTCTGCTCGTCGGCGCCAT
TCTCCATGTGCTCTATGCCGAGCGCGACAAGACCCTCGCCGGCGTCGCCGTCTTCCTCTCCGACCCCAGG
CGCCCCATCGAGGCGACACTCGCCGCCATGATGACGACGCCGCACCTCGGCGAGACGGGTCCTCATCCGG
TGATCGCCAGCGCGGCACGGGAGCTTCTCAATAAGTCGGAGAACGAGCGCTCCGGCGTTCTTTCCACCGC
CATGTCCTTCCTCGGGCTCTATCGCGATCCGGTGGTCGCCAAGGTGACCCGGCGCTGCGATTGGCGCATC
GCCGACCTTGTAGCGCACCGGCAGCCGACCACCCTCTATCTCGTCGTGCCGCCGTCCGACATCAACCGCA
CCAAGCCTCTGATCCGCCTGATCCTGAACCAGGTCGGGCGTCGCCTCACCGAGGACCTGCAGGCGAAGGC
CGGCCGCCATCGGCTCCTCCTGATGCTGGACGAGTTTCCGGCGCTGGGGCGGCTCGACTTCTTCGAGAGC
GCCCTCGCATTCATGGCGGGCTACGAGCTCAAGAGCTTCCTGATCGCGCAGAGCCTGAACCAGATCGAGA
AGGCCTATGGCCCGAACAATTCGATCCTCGACAACTGCCATGTGCGGGTGAGCTTTGCCACCAATGACGA
GCGCACCGCCAAGCGTGTCTCCGACGCCCTCGGCACCGCCACCGAGATGAAGGCCATGAAGAACTATGCC
GGCCACCGGCTCTCGCCCTGGCTCGGCCACCTGATGGTGTCGCGCTCGGAGACGGCCCGCCCGCTCCTCA
CGCCGGGTGAGGTGATGCAGCTTCCACCCGCCGACGAGATCGTCATGGTCGCCGGCACGCCGCCGATCCG
GGCGAAGAAGGCGCGGTACTATGAGGATGCGCGCTTCCGGGAGCGAATCCTGCAGCCACCTCTGCTTGCA
GAACCCAACGAGCAGCGCGCCGACGACTGGACCGTGTTGCCGTTGCCCGCACCCTCGCAACTGAGCCTGA
TGGTGCAGGGAAGGGATGATGAGGACACGACCGGGTCGGAGCGCCGACACCAGCCGGAGCTGGCTCGGGT
GGCTTCGGTCGAGGAGCTTGCATTACCGCAGAACGAGTTCGAGATCGACCTCGCGGACGAGAGTGAGGAC
GACGTCGCCCGAAACAGCCGCATGACGCGCGTCATGCAGGGTGTGGCGCGTCAGGTCTCGCTCGACCCCC
GCGACGGCATGGAGCTGTGA
 Primer design