SecReT4
Protein ID: 154247931
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_4010
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4440478..4441275 [-]
Productlytic transglycosylase
Component typeTrbN
UniProt IDA7IMI9
KEGG IDxau:Xaut_4010
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 265 a.a.     [Download]
>gi|154247931|ref|YP_001418889.1| lytic transglycosylase [Xanthobacter autotrophicus Py2]
MLQTDPFLRVPILVLVSMRAHARRHAVVFVLLSGVPFGWSTAVLTAEAPATQKLSSPADRYADFITEAAE
RFDIPAGWIRSVLRAESDGDARSTSPKGAMGLMQIMPQTWAELRVHYGLGDDPYDPHDNIMAGAAYLREL
FDRYGHPGFLAAYNAGPTRYEAFRKGRPLPRETRAYVEALAPVIAPDDAGADASRVSAAPQPEQPSWARA
PIFILPPTRTSTPATAPRERLPAEATATSAVRDVSAIVPPSAGLFVTRPGTGGAR
 
Nucleotide Sequence: 798 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4441275-4440478 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGCTGCAGACGGATCCGTTCCTGCGTGTCCCCATCCTCGTGCTCGTCTCGATGCGAGCGCACGCCCGTC
GCCACGCAGTCGTCTTTGTTCTCCTTTCCGGAGTGCCTTTCGGCTGGTCGACTGCTGTCCTCACGGCGGA
GGCTCCCGCGACCCAGAAGTTGTCGTCACCGGCCGATCGCTACGCCGATTTCATCACGGAGGCTGCGGAG
CGCTTCGACATTCCCGCAGGCTGGATCCGGTCCGTGCTGCGCGCCGAAAGTGACGGCGACGCGCGCTCGA
CCTCACCCAAAGGCGCCATGGGATTGATGCAGATCATGCCGCAGACTTGGGCCGAGCTGCGCGTCCACTA
TGGCCTCGGCGACGACCCCTACGACCCGCACGACAACATCATGGCCGGCGCTGCCTACCTGCGGGAGCTG
TTCGATCGCTACGGCCATCCCGGCTTCCTCGCGGCCTACAATGCGGGACCGACCCGCTACGAGGCCTTTC
GGAAGGGCCGCCCGCTGCCTCGGGAAACGCGCGCCTACGTCGAAGCGCTCGCGCCCGTCATCGCGCCCGA
CGACGCCGGCGCGGATGCCTCCAGAGTGTCCGCCGCGCCGCAGCCGGAGCAGCCATCGTGGGCTCGCGCT
CCGATCTTCATTCTGCCACCAACCCGCACGTCCACGCCCGCTACGGCACCCCGGGAGCGCTTGCCGGCAG
AAGCGACTGCAACGTCTGCGGTGCGCGATGTCTCCGCCATCGTCCCGCCATCGGCCGGCTTGTTCGTCAC
ACGACCGGGCACGGGAGGTGCGCGATGA
 Primer design