SecReT4
Protein ID: 154247932
T4SS name [ID]Trb [277]
Gene symbol-
Locus tagXaut_4011
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]4441320..4441865 [-]
Productpeptidase S26C conjugative transfer signal peptidase TraF
Component typeTraF
UniProt IDA7IMJ0
KEGG IDxau:Xaut_4011
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 4e-53, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|154247932|ref|YP_001418890.1| peptidase S26C conjugative transfer signal peptidase TraF [Xanthobacter autotrophicus Py2]
MTRFGYVMVTYFSVMGVAAVAFVPTSLKLVWNVSASAPVGLYAIEPARWLEVTELLAITPPAALARFLVE
RGYVGPGVPLMKRVAALPGQEVCRKGRAIMVDGVVYGDALDRDRMGRPLPVWRGCRRIAQGELFLMNFDV
PDSLDGRYFGPLPASTVIGRAVPIYTDEAGDGHFVWRAPTR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|154243958|ref|NC_009720.1|:c4441865-4441320 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACCCGCTTCGGCTATGTCATGGTGACGTATTTCTCGGTGATGGGGGTGGCGGCTGTCGCGTTCGTTC
CGACATCGCTCAAGCTGGTGTGGAACGTCTCCGCCAGCGCGCCCGTCGGGCTCTATGCCATCGAGCCGGC
GCGCTGGCTTGAGGTCACGGAGCTCCTCGCCATCACGCCACCGGCAGCGCTCGCCCGCTTCCTGGTGGAG
CGCGGTTATGTGGGCCCCGGTGTGCCGCTGATGAAGCGCGTGGCGGCGCTTCCCGGACAGGAGGTCTGCC
GCAAGGGCCGCGCCATCATGGTGGACGGCGTGGTCTATGGCGATGCGCTCGATCGCGACCGCATGGGCCG
TCCCCTGCCGGTCTGGCGCGGATGCCGTCGCATCGCCCAAGGCGAGCTCTTCCTCATGAATTTCGACGTG
CCGGACAGCCTCGACGGGCGGTATTTCGGCCCACTGCCCGCCAGCACCGTAATCGGCCGCGCCGTGCCGA
TCTACACCGACGAGGCCGGCGACGGGCACTTCGTCTGGCGTGCGCCGACGCGCTGA
 Primer design