SecReT4
Protein ID: 154251639
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1185
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1322551..1323735 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA7HSC3
KEGG IDpla:Plav_1185, pla:Plav_3550
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.8e-60, Aligned region: 211..389
Protein Sequence: 394 a.a.     [Download]
>gi|154251639|ref|YP_001412463.1| conjugation TrbI family protein [Parvibaculum lavamentivorans DS-1]
MSDIDHDNAERLDQSTPAVDASSSMRLRAEPPRVTRLSRKVLAGVAAVALVSIGGSLIYALQTRDPGKSA
DELYSTDNRTTADGLAGLPRDYTGPVLGPALPGDLGRPIVSAQNQGHPVVPPAMAAPGPDPEEQRRLAEL
EAARTSRVFFQAGPAATSATAGTNVPGFPSVGTGTQPGAETAQDRQLAFLNAPVDRRTIAADRIMAPASP
YVLQAGAVISAALITGIRSDLPGQITAQVTENIYDSPTGRILVIPQGTRIIGQYDNSVQYGQSRVLLVWN
RLILPNGRSIVLERQPGADTQGYAGLEDGVDYHWWDLAKAAGLSTLLSVGSELAIDDQDRLLRAIRNGGQ
DTINDAGQQIVRRQLNVAPTLTIRPGFPVRVIVTRDLVLEPYGG
 
Nucleotide Sequence: 1185 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1323735-1322551 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAGCGACATTGACCACGACAACGCCGAACGGCTGGACCAATCAACGCCCGCCGTCGATGCATCATCGT
CCATGCGCCTGCGGGCAGAACCTCCGCGCGTCACCCGGCTGTCGCGCAAAGTGCTCGCCGGCGTCGCTGC
GGTTGCACTCGTCAGCATCGGCGGCTCTCTCATCTACGCGCTCCAGACCCGCGATCCCGGCAAGAGCGCC
GACGAACTCTATTCAACCGACAACCGCACCACGGCCGACGGCCTGGCCGGCCTGCCACGCGATTACACCG
GCCCGGTCCTCGGCCCGGCGCTGCCTGGAGACCTCGGCCGCCCGATCGTCAGCGCGCAAAATCAGGGGCA
TCCTGTCGTGCCGCCCGCCATGGCGGCGCCGGGGCCTGATCCCGAGGAGCAACGTCGCCTAGCCGAATTG
GAGGCCGCCCGCACCAGCCGCGTGTTTTTCCAGGCCGGTCCGGCCGCAACGTCGGCGACCGCCGGCACGA
ATGTCCCGGGATTTCCCAGCGTGGGAACCGGCACACAACCTGGTGCCGAGACCGCTCAAGATCGACAACT
CGCGTTCCTCAATGCTCCCGTCGACCGCCGTACCATTGCGGCCGACCGCATCATGGCACCAGCATCGCCC
TATGTTCTCCAGGCGGGCGCGGTCATCTCCGCCGCCCTCATCACCGGCATCCGCTCCGATCTGCCTGGAC
AAATCACCGCGCAGGTGACGGAGAACATCTACGATAGTCCGACGGGGCGCATCCTCGTCATCCCACAGGG
CACGCGGATCATCGGCCAGTACGACAATAGCGTCCAATACGGGCAGAGCCGCGTGCTTCTCGTCTGGAAC
AGGCTCATTCTCCCGAACGGCCGGTCCATTGTGCTCGAACGACAACCCGGAGCCGATACCCAGGGCTATG
CCGGTCTGGAAGACGGCGTCGATTACCATTGGTGGGATCTCGCCAAAGCGGCGGGGCTCTCGACGCTCCT
GTCAGTCGGGTCCGAGCTTGCCATCGATGATCAGGACCGGCTCCTGCGCGCCATCCGCAATGGGGGCCAG
GACACGATCAATGATGCCGGTCAGCAGATCGTTCGGCGCCAGCTCAACGTCGCGCCGACACTGACGATCC
GGCCCGGCTTCCCTGTCCGCGTGATCGTCACCCGCGATCTCGTCCTCGAACCTTACGGAGGCTGA
 Primer design