SecReT4
Protein ID: 154251641
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1187
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1324709..1325398 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA7HSC5
KEGG IDpla:Plav_1187, pla:Plav_3548
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-60, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|154251641|ref|YP_001412465.1| conjugal transfer protein TrbF [Parvibaculum lavamentivorans DS-1]
MSLFKRPAAHYGKSPEPETPYQRAAQVWDDRMGSARVQARNWRIMAFGSLFLSAGFAAALVWQSARGTVV
PWVVQVDRLGQAQSVAPASADYRPTDPQVAWHLARFIEQVRSIPADPIIVRQNWLRAYDWTTDRGAGALN
DYARTNDPFTKVGKQQIAVEVSSVIRASADSFRVAWTEKRYENGQLAGTERWTAILTIVIQTPRDADRLR
ANPLGIYINAINWSREMSQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1325398-1324709 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAGCCTCTTCAAACGACCCGCCGCCCACTATGGGAAATCGCCCGAACCCGAAACACCCTATCAGCGCG
CCGCGCAGGTCTGGGACGATCGCATGGGTTCGGCCCGCGTCCAGGCCAGGAACTGGCGCATCATGGCATT
CGGCTCACTTTTCCTGTCGGCCGGCTTCGCCGCCGCGCTGGTCTGGCAGTCGGCGCGCGGCACCGTCGTT
CCCTGGGTGGTGCAGGTCGATCGGCTCGGTCAGGCGCAGTCCGTAGCACCGGCGTCGGCCGACTACCGGC
CGACCGATCCGCAGGTGGCCTGGCATCTTGCCCGCTTCATCGAGCAAGTCAGAAGCATCCCGGCCGATCC
GATCATCGTGCGCCAGAACTGGCTGCGCGCCTATGACTGGACCACGGATCGCGGCGCCGGCGCGCTCAAC
GACTATGCCCGCACCAACGATCCCTTCACCAAGGTCGGCAAACAGCAGATCGCCGTCGAGGTTTCGAGCG
TCATCCGCGCATCGGCGGATTCCTTCCGCGTGGCCTGGACCGAGAAACGGTACGAGAATGGCCAGCTCGC
GGGCACGGAGCGATGGACCGCGATCCTCACCATCGTCATCCAGACGCCGCGCGACGCCGACCGGCTGCGC
GCCAATCCGCTCGGCATCTACATCAACGCTATCAACTGGTCGCGGGAGATGTCCCAATGA
 Primer design