SecReT4
Protein ID: 154251642
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1188
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1325395..1326756 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7HSC6
KEGG IDpla:Plav_1188, pla:Plav_3547
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-55, Aligned region: 37..262
Protein Sequence: 453 a.a.     [Download]
>gi|154251642|ref|YP_001412466.1| conjugal transfer protein TrbL [Parvibaculum lavamentivorans DS-1]
MGGAGVIDNFLGVFTSYINSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGAEDDIIARLVKKTLFVGVF
AYLIGNWNNLAKIVFDSFAGLGLKASGTSFTAQDLMRPGKVAQTGLDAARPLLESISDLMGWIAFFENFI
QIACLLFAWALVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTAGFGGATPTIDDAMAIVLAALSLLGLGIFGPGIAAGLVSGGPQLGAGAAVGTGLA
VGGAALAAGGAAGLAIKGGAAAMSGGAAAVRGGAAAAGGAAAAYSVGSLGQSGAAGVASGLGGVARAAGA
AAVSPLRRATARVAEGVKSSFSEGAKAGFGATGGSSTMSTIPGSGSAGEAAAAAPGDGPPDWAKRMKRHQ
SLSHGATLAAHAVKSGDSHGGGSSVNLSESNRS
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1326756-1325395 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGGGCGGCGCAGGTGTCATCGACAATTTCCTCGGGGTCTTCACCTCCTACATCAACAGCGGGTTCGGAC
TGCTCGGCGGCGAGGTCGCGTTCATCGCCACAACGCTGATCGTCATCGATGTGACGCTTGCCGCCCTGTT
CTGGAGCTGGGGCGCGGAAGACGACATCATCGCCCGGCTGGTGAAAAAGACGCTCTTCGTCGGCGTCTTC
GCCTATCTCATCGGCAACTGGAACAACCTCGCCAAGATCGTCTTCGACTCGTTCGCGGGCCTCGGCCTCA
AGGCTTCCGGCACCAGCTTCACCGCGCAGGATCTGATGCGACCCGGCAAGGTCGCGCAGACCGGGCTCGA
CGCCGCGCGCCCCTTGCTCGAATCCATCTCCGACCTGATGGGCTGGATCGCGTTCTTCGAGAACTTCATC
CAGATCGCCTGCCTGCTGTTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCATCCTCGCGATCCAGCTCT
TCGTTACCCTGATCGAATTCAAGTTGACGACGCTGGCGGGCTTCGTCCTCATCCCGTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTGGGCAATGTCGTCTCATCCGGCATCAAGGTGCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCAACGCTGTTCAGCCAGTTTACGGCCGGCTTCGGCGGCGCAACGCCCA
CAATCGACGACGCCATGGCGATTGTTCTTGCCGCGCTATCGCTGCTCGGGCTCGGCATCTTCGGCCCCGG
CATTGCTGCCGGTCTGGTCAGCGGCGGACCACAACTCGGCGCCGGTGCGGCGGTTGGCACCGGGCTTGCC
GTCGGCGGTGCCGCGCTCGCAGCTGGTGGCGCGGCAGGCCTTGCCATAAAGGGAGGAGCGGCTGCGATGT
CCGGCGGTGCTGCTGCCGTGCGGGGCGGTGCGGCAGCGGCAGGCGGAGCCGCCGCGGCCTACAGTGTCGG
CTCGCTCGGCCAGTCCGGCGCAGCCGGTGTCGCCTCTGGTCTTGGCGGTGTCGCCCGCGCGGCCGGAGCA
GCCGCCGTGTCGCCCCTGAGACGCGCGACGGCGCGCGTCGCCGAAGGCGTCAAGTCCAGCTTCTCCGAAG
GTGCGAAGGCAGGCTTCGGCGCAACGGGCGGTTCCTCGACCATGAGCACGATACCCGGCTCAGGCTCCGC
AGGCGAAGCCGCCGCCGCAGCGCCCGGCGACGGTCCGCCCGACTGGGCCAAGCGCATGAAGCGCCATCAG
TCCCTCAGCCACGGAGCCACCCTCGCAGCGCACGCCGTCAAATCCGGCGACAGCCATGGCGGCGGCTCTT
CCGTCAATCTCTCCGAAAGTAACCGCTCATGA
 Primer design