SecReT4
Protein ID: 154251644
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1190
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1327055..1327834 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA7HSC8
KEGG IDpla:Plav_1190, pla:Plav_3545
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 9.1e-05, Aligned region: 18..58
Protein Sequence: 259 a.a.     [Download]
>gi|154251644|ref|YP_001412468.1| conjugal transfer protein TrbJ [Parvibaculum lavamentivorans DS-1]
MNTLRSRPRAMSLAAFILAIPLAASPVLTAPAHAQFGFGGIVYDPTNYAQNVLTAARSLEQINNQIRSLQ
NEAQSLINQAKNLANLPYSALQQIQQNVQRTQQLLGQAENISFDVQNVDRMFQQQYGSVSLSSSDAKLIT
DARSRWQNTVGGLQDAMRIQAGVVGNIDSNRTQMSNLVSQSQGAQGALQATQAGNQLLALQSQQLSDLIA
LISANGRATALTDAERAAAADQGREQRRRFLTPGAGYQPGNAQMFGNGN
 
Nucleotide Sequence: 780 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1327834-1327055 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAATACGCTTCGTTCACGCCCGCGCGCGATGTCGCTCGCGGCCTTCATCCTGGCGATACCGCTCGCCG
CATCGCCGGTGCTGACCGCGCCAGCGCACGCGCAATTCGGCTTCGGCGGTATCGTCTATGACCCTACCAA
CTACGCCCAGAACGTCCTGACGGCGGCGCGGTCCCTCGAGCAGATCAACAACCAGATCCGCTCGCTTCAA
AACGAGGCGCAGAGCCTCATCAACCAAGCCAAGAATCTGGCGAACCTGCCGTACTCGGCGCTCCAGCAGA
TTCAACAGAACGTCCAACGCACCCAGCAGCTCCTCGGCCAGGCGGAGAACATCTCTTTCGACGTCCAGAA
CGTCGATCGGATGTTCCAGCAGCAATATGGCAGCGTCTCACTGTCGTCGTCGGACGCCAAGCTCATCACC
GACGCTCGCTCGCGCTGGCAGAACACCGTCGGCGGCTTGCAGGACGCCATGCGCATTCAGGCCGGTGTCG
TCGGCAATATCGACAGCAATCGCACGCAGATGTCGAACCTCGTCAGCCAGAGTCAAGGCGCGCAGGGTGC
GTTGCAGGCGACACAGGCCGGCAATCAGCTTCTCGCGCTGCAATCGCAGCAGCTCTCCGACCTGATCGCG
CTGATCTCCGCCAACGGCCGGGCCACGGCGCTGACTGACGCGGAGCGCGCGGCGGCGGCTGATCAGGGCC
GGGAGCAGCGCCGCCGCTTCCTCACGCCGGGCGCGGGCTATCAGCCCGGCAACGCGCAGATGTTCGGCAA
CGGCAACTGA
 Primer design