SecReT4
Protein ID: 154251645
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1191
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1327840..1330290 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA7HSC9
KEGG IDpla:Plav_1191, pla:Plav_3544
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1e-33, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 1.2e-14, Aligned region: 175..388
Protein Sequence: 816 a.a.     [Download]
>gi|154251645|ref|YP_001412469.1| conjugal transfer ATPase TrbE [Parvibaculum lavamentivorans DS-1]
MMNLAEYRRTATRLADYLPWAALVAEGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVAGRLNNAFRRLG
SGWAIFVEAQRHEASIYPADLFPDAAAALLDAERKADFEEAGAHYVSGYYLTITYLPPAEDAARTEAWLY
EGRERAGIDPKEILNTFVDRTDRVLALLDGFMPECQWLDSSETLTYLHSTVSTKRHRVRVPETPVYLDAL
LADQPLTGGLEPRLGTAHLRVLTIVGFPTATTPGILDDLNRLAFPYRWSTRAILLDKTDATKLLTKIRRQ
WFAKRKSIAAILKEVLTNEASALVDTDASNKAADADLALQELGADYAGQSYVTATIAVWDNDPRVADEKL
RLAEKVIQGRDFTAMTETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHLGSSP
LLFGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLAIMALQFRRYAGAQVFAFDFGGSIRTAALAMG
GDWHDLGGDLTEGVDSSVSLQPLARIHDTPERAWAADWIVAILIREGIAITPEVKEHLWSALTSLASAPV
EERTITGLTVLLQSNDLKQALRPYCVGGPYGRLLDAEAEHLGSASVQAFEIEGLVGTGAAPAVLAYLFHR
IGDRLDGSPTLLIIDEGWLALDDDAFSGQLREWLKTLRKKNASVIFATQSLSDIDNSNIAPAIIESCPTR
LLLPNERAIEPQITEIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVGLALAATSSKTDQ
SEIARTVAEHGREGFLAAWLRLRGAEWAADLIPDLTNLTPQQSEKE
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1330290-1327840 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGATGAATCTTGCCGAATATCGCCGCACCGCAACCCGCCTCGCTGACTATCTGCCCTGGGCCGCGCTCG
TCGCCGAGGGCGTCGTGCTCAACAAGGACGGCAGCTTTCAGCGCACGGCGCGGTTCCGCGGCCCTGATCT
GGACTCCGCGGTCGCCGCCGAACTGGTCGCCGTCGCCGGGCGGCTCAACAACGCATTCCGTCGTCTCGGA
TCGGGTTGGGCCATCTTCGTCGAGGCGCAGCGGCACGAGGCGTCGATCTATCCAGCGGACCTGTTTCCCG
ACGCCGCCGCAGCGCTTCTCGATGCCGAGCGCAAAGCCGATTTCGAGGAGGCCGGCGCGCATTACGTCTC
CGGCTACTATCTCACCATCACCTATCTGCCGCCGGCCGAGGATGCCGCGCGCACCGAAGCCTGGCTCTAT
GAGGGCCGCGAACGTGCTGGCATCGATCCGAAGGAAATCCTGAACACCTTTGTCGACCGCACCGATCGCG
TGCTGGCGCTGCTCGACGGCTTCATGCCGGAATGCCAGTGGCTCGATAGCAGCGAGACGCTGACATATCT
CCATTCGACCGTCTCGACCAAACGGCACCGCGTCCGTGTGCCCGAAACGCCGGTCTATCTCGACGCGCTG
CTCGCCGACCAACCGCTCACCGGCGGCCTGGAGCCGCGTCTCGGAACCGCGCATCTGCGCGTTCTCACCA
TTGTCGGTTTCCCGACCGCGACCACGCCCGGCATCCTCGACGATCTCAATCGGCTCGCCTTTCCCTATCG
CTGGTCGACGCGCGCCATCCTGCTCGACAAGACCGACGCGACCAAGCTGCTGACCAAAATCCGCCGCCAA
TGGTTCGCGAAGCGCAAAAGCATCGCCGCGATCCTGAAAGAGGTGCTGACCAACGAGGCGTCCGCGCTGG
TCGATACCGACGCCTCGAACAAGGCGGCGGACGCCGATCTCGCCCTCCAGGAACTCGGCGCTGACTACGC
CGGCCAATCCTATGTCACCGCGACGATCGCGGTATGGGACAACGATCCCCGAGTTGCCGACGAGAAGCTT
CGCCTCGCCGAGAAAGTCATCCAGGGCCGCGACTTCACGGCCATGACTGAAACGATCAATGCCGTCGATG
CCTGGCTGGGCTCATTGCCGGGGCATGTTTACGCCAACGTGCGCCAGCCCCCGATTTCGACGCTGAATCT
CGCCCACATGATCCCGCTCTCGGCGGTGTGGGCGGGGCCGGAACGGGACGAGCATTTGGGTAGCTCCCCC
TTGCTGTTCGGCAAGACCGAAGGCTCGACCCCGTTCCGGTTTTCTCTCCATGTCGGCGACGTCGGTCACA
CGCTCGTCGTCGGCCCGACCGGCGCCGGCAAATCGGTGCTCCTCGCCATCATGGCCTTGCAGTTCCGGCG
CTATGCCGGTGCCCAGGTCTTCGCCTTCGACTTCGGCGGTTCGATCCGCACCGCCGCGCTCGCCATGGGC
GGTGATTGGCACGATCTCGGCGGCGATCTCACCGAGGGCGTGGACTCCTCGGTCTCGCTGCAACCGCTCG
CGCGCATTCACGACACGCCCGAACGCGCCTGGGCGGCCGACTGGATCGTCGCCATCCTGATCCGCGAGGG
CATCGCAATCACCCCCGAGGTGAAGGAGCACCTCTGGTCGGCGCTGACCTCGCTGGCGTCGGCGCCGGTC
GAGGAACGCACGATCACCGGCCTCACGGTGTTGCTCCAATCGAACGACCTGAAGCAGGCTCTGCGACCGT
ATTGCGTGGGCGGCCCCTATGGGCGGCTACTCGACGCCGAGGCCGAACATCTCGGCTCGGCATCGGTGCA
GGCGTTCGAGATCGAGGGACTGGTCGGGACTGGCGCGGCACCCGCCGTCCTCGCCTATCTCTTCCATCGC
ATCGGCGACCGTCTCGACGGCTCGCCGACGCTGCTCATCATCGACGAGGGCTGGCTCGCACTCGATGACG
ATGCCTTCTCCGGGCAATTGCGCGAATGGCTGAAGACGCTGCGCAAGAAAAACGCCAGCGTCATCTTCGC
CACGCAGTCGCTGTCCGACATCGACAACAGCAACATCGCCCCGGCCATCATCGAGAGCTGCCCGACAAGG
CTGCTCCTGCCGAACGAACGCGCGATCGAGCCGCAGATCACGGAGATCTATCGGCGCTTCGGTCTCAACG
ACCGCCAGATCGAAATCCTCGCGCGGGCCACGCCCAAGCGCGACTATTACTGCCAGTCGCGGCGCGGCAA
TCGCCTGTTCGAGCTGGGCCTCTCCGAAGTCGGTCTCGCGCTCGCCGCCACCTCCTCCAAGACCGACCAG
TCCGAGATCGCGCGCACCGTCGCCGAGCATGGCCGCGAGGGCTTTCTCGCCGCCTGGCTGCGCCTGCGCG
GCGCCGAGTGGGCCGCAGACCTCATCCCTGACCTCACGAACCTCACCCCCCAGCAGTCCGAGAAGGAGTA
A
 Primer design