SecReT4
Protein ID: 154251646
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1192
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1330305..1330586 [-]
Productconjugal transfer protein TrbB
Component typeTrbD
UniProt IDA7HSD0
KEGG IDpla:Plav_1192, pla:Plav_3543
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-10, Aligned region: 16..84
Protein Sequence: 93 a.a.     [Download]
>gi|154251646|ref|YP_001412470.1| conjugal transfer protein TrbB [Parvibaculum lavamentivorans DS-1]
MAAAFEQLDAVPGFTVPVHRALTEHILLGGAPRALAILNGTLAGAVGLGLRLWLVGLLIWAIGHIAAVWA
AKRDPLFVEVGRRHLRIPAHLSV
 
Nucleotide Sequence: 282 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1330586-1330305 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGGCGGCGGCGTTCGAACAACTCGACGCGGTGCCGGGTTTCACCGTCCCGGTTCACCGGGCGCTGACCG
AGCACATTCTGCTCGGCGGCGCACCGCGCGCACTCGCCATCCTGAACGGCACGCTGGCCGGAGCCGTGGG
CCTTGGCCTGCGCCTCTGGCTCGTCGGTCTGCTGATCTGGGCCATTGGCCATATCGCAGCCGTATGGGCT
GCAAAGCGCGATCCCCTCTTCGTCGAGGTCGGTCGCCGTCACCTGCGCATCCCCGCTCATCTGTCCGTCT
GA
 Primer design