SecReT4
Protein ID: 154251647
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1193
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1330586..1330918 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7HSD1
KEGG IDpla:Plav_1193, pla:Plav_3542
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.2e-23, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|154251647|ref|YP_001412471.1| conjugal transfer protein TrbC [Parvibaculum lavamentivorans DS-1]
MIRTTMRVRRYAATAAAFIYINLVLVPAAHASGSSMPWEAPLQKILESIEGPVAKIVAVIIIIATGLALA
FGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1330918-1330586 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGATCCGCACCACCATGCGCGTTCGCCGCTATGCCGCGACGGCCGCCGCCTTCATCTACATCAATCTCG
TCCTCGTTCCCGCCGCCCATGCCTCCGGCTCGTCCATGCCGTGGGAAGCACCGCTCCAGAAAATTCTCGA
ATCCATCGAAGGGCCGGTCGCCAAGATCGTCGCCGTCATCATCATCATCGCCACCGGCCTGGCGCTGGCG
TTCGGTGACACGTCCGGCGGCTTCCGGAAGCTGATCCAGATCGTCTTCGGTCTCAGCATCGCGTTTGCGG
CGTCGAGCTTCTTCCTGTCGTTCTTCTCATTCGGCGGCGGGGCGCTCATCTGA
 Primer design