SecReT4
Protein ID: 154251648
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1194
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1330915..1331898 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA7HSD2
KEGG IDpla:Plav_1194, pla:Plav_3541
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.9e-86, Aligned region: 25..290
FtsK_SpoIIIE [PF01580], Evalue: 2.3e-05, Aligned region: 140..178
Protein Sequence: 327 a.a.     [Download]
>gi|154251648|ref|YP_001412472.1| P-type conjugative transfer ATPase TrbB [Parvibaculum lavamentivorans DS-1]
MTNISQKPEAFARGARMLRTALGSTITHFLEDPAVVEIMLNPDGRLWVDRLSEGLADTGETLSPADGERI
VRLVAHHVGVEVHPRSPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAVAIFTLDDYVAAGIMFADQAA
TLRAAVMARANILVAGGTSTGKTTLTNALLAEVAKTADRVVIIEDTRELQCAAPNLVAMRTKDGVATLSE
LVRSSLRLRPDRIPIGEVRGSEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVVTVPRALIA
ETIDLVAVLSGRGSARRLAELARVDGLGPDGDYAITPATLDRTGAPS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1331898-1330915 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGACCAATATCAGCCAGAAGCCGGAGGCGTTCGCGCGCGGTGCGCGCATGCTTCGCACCGCGCTCGGCT
CGACCATCACCCATTTTCTCGAAGACCCGGCCGTGGTCGAAATCATGCTGAACCCGGACGGCCGTCTCTG
GGTAGATCGCCTCTCCGAAGGGCTGGCCGATACGGGTGAGACGCTGTCGCCTGCCGATGGCGAGCGCATC
GTGCGGCTGGTCGCTCACCATGTCGGCGTCGAGGTGCATCCGCGCAGCCCGCGAGTCTCCGCCGAGCTTC
CTGAGACGGGAGAGCGGTTCGAGGGCTTGCTGCCGCCCGTTGTCGCCGCACCGGCCTTCGCCATCCGCAA
GCCCGCCGTAGCGATCTTCACGCTCGACGATTATGTGGCCGCCGGAATCATGTTCGCCGACCAGGCGGCG
ACGCTACGCGCAGCCGTGATGGCGCGCGCCAATATCCTTGTCGCAGGCGGCACTTCCACCGGCAAAACCA
CGCTGACCAATGCGCTTCTGGCCGAGGTCGCCAAGACGGCGGATCGCGTCGTCATCATCGAGGATACCCG
CGAGCTTCAGTGCGCCGCGCCCAATCTTGTCGCCATGCGGACCAAGGATGGAGTGGCCACGCTCTCGGAG
CTGGTTCGCTCTTCGCTACGCCTGCGCCCCGATCGCATTCCCATCGGCGAGGTGCGCGGCTCTGAAGCTC
TCGATCTCCTGAAAGCATGGGGAACCGGCCACCCCGGCGGCATCGGCACGATCCACGCCGGGAGCGGCAT
CGGCGCGCTGCGCCGCCTTGAACAACTCATCCAGGAGGCCGTCGTCACGGTCCCGCGCGCCCTGATCGCC
GAGACCATCGATCTTGTTGCCGTCCTCTCCGGCCGCGGCTCCGCGCGCCGGCTCGCCGAACTCGCCCGCG
TCGATGGGCTCGGTCCGGACGGCGACTACGCCATCACCCCCGCAACCCTTGACCGTACAGGAGCGCCATC
ATGA
 Primer design