SecReT4
Protein ID: 154251650
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1196
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1332521..1334512 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA7HSD4
KEGG IDpla:Plav_1196, pla:Plav_3539
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.3e-101, Aligned region: 111..554
TraG-D_C [PF12696], Evalue: 1.6e-30, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 5.4e-28, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 1.6e-05, Aligned region: 146..478
Protein Sequence: 663 a.a.     [Download]
>gi|154251650|ref|YP_001412474.1| conjugal transfer coupling protein TraG [Parvibaculum lavamentivorans DS-1]
MSATKILWGQIAVVFLIVLLTTWAATQYVAWSLGFQAQLGTPWFSLFGLPIYYPPAFFWWWYFYDAYAPE
VFAKGGMISASGGFIAIAVAIGMSVWRAREAKSAATYGSARWAGKDEVKAAGLLSPDGVVLGRYDRDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNPKSSAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEDDKTLAGVAAFLSDPK
RPIESTLAAMMKTSHLGEAGPHLVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAEVTRRCDWRI
SDMVGGKLPTTLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKVGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLSPWLGHLMVSRSETARQLLTPGEIMQLPPTDEIVMVAGTPPIRAKKARYYEDARFKERIMSPPGLA
RPAEGRPDDWSKLPIPARPDMTENAAPTTSGDNEEDSTESERRHQPELNRVNPIEKKAPIDNEFEIDLPD
DTEDAAARNQRLTRVMRGVARQVSLDPNDGMEL
 
Nucleotide Sequence: 1992 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1334512-1332521 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGTCCGCGACCAAAATCCTGTGGGGCCAGATCGCCGTCGTCTTCCTCATCGTGCTGCTCACCACCTGGG
CGGCGACGCAATATGTCGCATGGAGCCTCGGCTTTCAGGCGCAGCTCGGCACGCCCTGGTTTTCCCTGTT
CGGCCTACCGATCTACTATCCGCCAGCGTTCTTCTGGTGGTGGTATTTCTACGACGCCTACGCGCCGGAG
GTCTTCGCCAAGGGCGGGATGATCTCGGCGTCGGGCGGCTTCATCGCCATAGCCGTCGCCATCGGCATGT
CGGTCTGGCGCGCCCGCGAAGCAAAAAGCGCGGCGACCTACGGCTCCGCCCGCTGGGCGGGAAAGGACGA
AGTGAAAGCCGCGGGCCTGCTCAGTCCCGACGGTGTCGTGCTCGGCCGCTATGATCGCGACTATCTCCGT
CATGACGGCCCCGAGCATGTGCTTTGCTTCGCCCCGACCCGATCGGGCAAGGGCGTCGGCCTGGTCGTGC
CGTCCCTGTTGACCTGGCCGGGCTCGGCCATCGTCCACGACATCAAAGGGGAAAACTGGCAGCTCACCGC
CGGTTTCCGCGCCCGGCATGGCCGCGTTCTGCTGTTCGACCCGACCAACCCCAAATCGTCGGCCTACAAT
CCGCTGCTCGAGGTGCGCCGCGGCGAATGGGAAGTCCGCGACGTTCAGAACATCGCTGACATCCTGGTCG
ATCCCGAAGGCTCGCTCGAAAAGCGGAACCATTGGGAGAAGACCAGTCATGCCCTGCTGGTCGGCGCCAT
CCTGCATGTCCTCTACGCCGAAGACGACAAGACATTGGCCGGCGTCGCCGCCTTCCTGTCCGATCCGAAG
CGCCCGATCGAGTCGACGCTTGCCGCGATGATGAAGACCAGCCACCTCGGCGAAGCCGGGCCGCATCTCG
TCATCGCCAGCGCCGCACGCGAGCTGCTCAACAAATCGGACAACGAACGCTCGGGCGTGCTCTCCACCGC
CATGTCGTTTCTCGGCCTCTACCGCGATCCTGTCGTCGCCGAGGTGACGCGGCGCTGCGACTGGCGGATC
AGCGACATGGTGGGCGGCAAGCTCCCGACCACACTCTACCTTGTCGTGCCGCCGTCCGACATCAACCGCA
CCAAGCCGCTGATACGCCTGATCCTCAATCAGGTCGGTCGCCGTCTCACCGAGGATCTGCAAGCAAAGGT
CGGGCGGCATCGCCTGCTGCTCATGCTCGACGAGTTTCCCGCCCTCGGCCGCCTCGATTTCTTCGAGTCC
GCGCTGGCTTTCATGGCGGGCTACGGCCTCAAGAGCTTTCTGATCGCGCAATCGCTGAACCAGATCGAGA
AGGCTTACGGCCCGAACAATTCGATCCTCGACAACTGCCATGTGCGCGTTTCCTTTGCGACGAACGACGA
AAGGACCGCGAAGCGGGTCAGCGACGCGCTCGGAACCGCGACCGAGATGAAGGCGATGAAGAATTACGCC
GGGCATCGGCTCTCGCCCTGGCTCGGCCATTTGATGGTGTCGCGCTCGGAGACCGCGCGTCAGCTCCTGA
CACCAGGCGAAATCATGCAGCTCCCGCCGACCGACGAGATCGTCATGGTCGCCGGGACGCCGCCGATCCG
GGCGAAGAAGGCGCGCTACTATGAAGATGCCCGCTTCAAGGAACGCATCATGTCACCGCCGGGGCTGGCG
CGGCCTGCTGAAGGTCGGCCCGACGATTGGAGCAAGCTGCCGATCCCCGCGCGCCCGGACATGACCGAAA
ACGCTGCGCCAACGACGAGCGGTGACAACGAAGAGGATTCCACCGAGTCCGAACGTCGGCATCAGCCCGA
ACTCAACCGGGTGAACCCCATCGAAAAGAAGGCGCCGATCGACAATGAGTTTGAGATCGATTTGCCTGAC
GACACAGAGGACGCCGCCGCGCGCAACCAGCGGCTGACCCGCGTCATGCGCGGCGTTGCCCGCCAGGTCT
CGCTCGATCCCAATGACGGCATGGAGCTGTAG
 Primer design