SecReT4
Protein ID: 154251652
T4SS name [ID]Trb [339]
Gene symbol-
Locus tagPlav_1198
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1336522..1337301 [-]
Productlytic transglycosylase catalytic subunit
Component typeTrbN
UniProt IDA7HSD6
KEGG IDpla:Plav_1198, pla:Plav_3537
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 259 a.a.     [Download]
>gi|154251652|ref|YP_001412476.1| lytic transglycosylase catalytic subunit [Parvibaculum lavamentivorans DS-1]
MSGPRPAISHRDAGGRHHAVRRMAFLLLSGLALAAGATDAALAQSVSAARTVAGDPHAAFVTEASQRFGI
PEHWIVAVKRAESAGDVRAISSAGALGLMQVMPDTWAALRVRYGLGRAPYDPRDNILAGAAYLREMFDRY
RTIPAMLGAYNAGPGRYDEYVQTGRALPAETRAYIALLAPQLGAPSPSSAPPVAPPPPPDWREAPLFVVR
SADDRSATSPSENARSNDSRSSVAARTPDTAEDSNAPIVVARSDGGTPR
 
Nucleotide Sequence: 780 bp     [Download]
>gi|154250456|ref|NC_009719.1|:c1337301-1336522 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGTCCGGTCCACGTCCAGCGATAAGCCATCGGGATGCGGGCGGGCGGCATCACGCCGTCCGGCGCATGG
CCTTCCTTCTCCTTTCCGGCCTGGCCCTCGCAGCGGGCGCAACGGACGCCGCTCTTGCCCAGTCCGTGTC
GGCTGCGCGCACGGTCGCTGGCGATCCACACGCCGCCTTCGTCACCGAAGCCTCGCAGCGCTTCGGCATT
CCCGAACACTGGATCGTCGCCGTCAAACGCGCCGAAAGCGCCGGCGATGTGCGCGCCATATCGTCGGCCG
GCGCGCTCGGGTTGATGCAGGTCATGCCCGATACCTGGGCCGCGCTTCGCGTTCGCTATGGGCTCGGGCG
TGCCCCCTACGACCCGCGCGACAACATCCTCGCAGGCGCTGCCTACCTGCGTGAAATGTTCGACCGCTAT
CGCACGATCCCCGCAATGCTCGGCGCCTACAATGCGGGGCCTGGCCGCTACGACGAATACGTCCAGACCG
GCCGCGCCCTGCCCGCCGAAACGCGGGCCTACATCGCGCTGCTGGCTCCGCAGCTAGGCGCACCATCGCC
GTCGAGCGCGCCACCGGTTGCGCCGCCACCGCCGCCGGATTGGCGGGAAGCGCCGCTCTTCGTCGTGCGT
TCCGCCGACGATCGTTCGGCGACATCGCCATCGGAAAACGCGCGGTCAAACGACAGCCGCTCCTCCGTCG
CGGCGCGCACTCCCGATACCGCCGAAGACTCGAACGCCCCGATCGTGGTCGCTCGCTCTGACGGGGGGAC
GCCCCGATGA
 Primer design