SecReT4
Protein ID: 154252286
T4SS name [ID]Trb [340]
Gene symbol-
Locus tagPlav_1836
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1987735..1988058 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7HU70
KEGG IDpla:Plav_1836
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-23, Aligned region: 7..96
Protein Sequence: 107 a.a.     [Download]
>gi|154252286|ref|YP_001413110.1| conjugal transfer protein TrbC [Parvibaculum lavamentivorans DS-1]
MRLPHRLVRTGALSLFLSLMFIGAAEAAGTGMPWEQPLQQILDSVQGPVAKIVAVIIIIVTGLTLAFGDT
AGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGAVIA
 
Nucleotide Sequence: 324 bp     [Download]
>gi|154250456|ref|NC_009719.1|:1987735-1988058 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCGCTTGCCCCATCGTCTCGTCCGAACCGGTGCGCTGTCCCTGTTCTTGAGCCTCATGTTTATCGGTG
CCGCAGAGGCCGCCGGCACCGGCATGCCCTGGGAGCAGCCGTTGCAGCAGATCCTCGATTCCGTGCAAGG
CCCGGTCGCGAAGATCGTCGCGGTGATCATCATCATCGTGACCGGGCTGACGCTCGCCTTCGGCGATACG
GCGGGCGGCTTCCGGCGCCTGATCCAGATCGTTTTCGGCCTGTCGATCGCCTTTGCCGCTTCGAGTTTCT
TTCTTTCCTTCTTCTCCTTCGGCGGCGGGGCGGTGATCGCATGA
 Primer design