SecReT4
Protein ID: 154252290
T4SS name [ID]Trb [340]
Gene symbol-
Locus tagPlav_1840
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1991511..1992674 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7HU74
KEGG IDpla:Plav_1840
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3e-47, Aligned region: 37..261
Protein Sequence: 387 a.a.     [Download]
>gi|154252290|ref|YP_001413114.1| conjugal transfer protein TrbL [Parvibaculum lavamentivorans DS-1]
MDDLGVIDRFMEAFTQAVDSGFGLLQGDVAFLTAILIGIDITLAGLFWAMEEGNVLGRLLRKVLYVGVFA
LILNNFAGLADIIFRSFAGLGLRAAENELTADDLLRPGYLAGIGFEAAWPLLQQAGSLMGFTSFFNHAVT
IIVLVLAWTVVIAAFFILAVQLFITIIEFKLTTLAGFVLVPFALWTKTAFLAERVLGNVVASGVKVMLLA
VIIGIGSGFFTDFVTALQGREPNLNDAMALVLASLALFGLGIFGPGIAAGLVSGAPQLGAGAAVGATGGV
AAGAALAGGAAFGAARIGGGTGLSALRAGTGMSTATAGASAMGSAAGMAASSSAGMSSSMAAGTPDWARR
LRAEQRRRTHTQTAIQAIREGDRPGAGANPSFDDGRS
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|154250456|ref|NC_009719.1|:1991511-1992674 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGGACGATCTCGGCGTCATCGACCGCTTTATGGAAGCCTTCACGCAAGCAGTCGACAGCGGCTTCGGGC
TATTGCAGGGCGATGTCGCCTTCCTGACCGCGATATTGATCGGTATCGACATCACGCTGGCCGGTCTCTT
CTGGGCGATGGAGGAGGGCAATGTGCTCGGTCGCCTCCTGCGGAAGGTGCTCTATGTCGGCGTCTTCGCA
CTGATCCTGAATAATTTCGCAGGCCTCGCCGATATCATCTTCCGCTCCTTCGCAGGTCTCGGGCTTCGTG
CGGCGGAGAACGAACTCACCGCCGACGATCTGCTCCGGCCGGGCTATCTCGCCGGCATCGGCTTCGAGGC
GGCCTGGCCGCTTCTGCAGCAGGCAGGCTCGCTGATGGGCTTCACAAGTTTCTTCAACCATGCCGTCACC
ATCATCGTGCTGGTACTTGCCTGGACCGTCGTCATCGCCGCCTTTTTTATTCTCGCGGTACAACTCTTCA
TCACCATCATAGAGTTCAAGCTGACGACGCTGGCGGGCTTTGTACTGGTGCCCTTCGCGCTCTGGACCAA
AACGGCGTTTCTGGCGGAGCGCGTGCTCGGCAATGTCGTCGCCTCGGGCGTCAAGGTGATGCTGCTCGCG
GTCATCATCGGCATCGGTTCGGGCTTCTTCACCGATTTCGTGACGGCGCTTCAGGGCCGCGAGCCCAACC
TCAACGACGCCATGGCACTGGTGCTCGCCTCGCTCGCCTTATTCGGTCTCGGTATCTTCGGGCCGGGCAT
CGCGGCGGGTCTCGTCTCCGGCGCGCCGCAGCTCGGCGCCGGCGCGGCGGTCGGCGCGACCGGCGGCGTC
GCGGCTGGTGCGGCGCTTGCAGGCGGAGCCGCATTTGGCGCCGCGCGGATAGGGGGTGGTACCGGACTTT
CGGCACTTCGGGCCGGCACCGGCATGAGCACCGCGACGGCAGGTGCATCGGCGATGGGGTCTGCGGCGGG
CATGGCCGCATCATCCTCCGCCGGAATGTCTTCAAGCATGGCGGCGGGCACGCCCGACTGGGCGCGGCGT
CTCCGCGCCGAGCAGCGCCGCCGCACCCATACCCAGACCGCGATTCAGGCGATCCGCGAAGGCGACCGGC
CGGGCGCCGGCGCCAATCCTTCCTTCGATGATGGGAGGTCCTGA
 Primer design