SecReT4
Protein ID: 154252292
T4SS name [ID]Trb [340]
Gene symbol-
Locus tagPlav_1842
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]1993387..1994406 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7HU76
KEGG IDpla:Plav_1842
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-67, Aligned region: 101..320
Protein Sequence: 339 a.a.     [Download]
>gi|154252292|ref|YP_001413116.1| P-type conjugative transfer protein TrbG [Parvibaculum lavamentivorans DS-1]
MTPIRSFLMVSISALVLTACADKVPPPQIRYDAADLQPAQLEPQAPKPVEIVAMPEPLPLPGQLQPLDTA
KPKPDKRVPTERVDAANKVALIEPMRDGYINAIQVYPFAEGALYRLYAAPERVSDIALQPGEELIAVSAG
DTVRWVIGDTVSGSGAGKRIHVLVKPFAAGLETNLVITTDRRAYHLALESTETTAMAALSWTYPRDELLA
LQARNARAEASSAIAGGVDLAALRFRYEITGDDPPWRPLRAFDDGAKVYIEFPARLDQGEAPPLFVVGPS
GGSELVNYRMRGHYYIVDRLFAAAELRLGEAPQQVVRISRADRVVNTGDNRPARLRPGR
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|154250456|ref|NC_009719.1|:1993387-1994406 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGACCCCGATCCGTTCGTTCTTGATGGTAAGCATCTCGGCGCTTGTGTTAACCGCCTGCGCCGACAAGG
TGCCGCCGCCCCAGATCCGCTATGACGCGGCCGATCTGCAACCGGCACAGCTCGAACCTCAGGCCCCGAA
ACCCGTCGAGATTGTTGCCATGCCCGAGCCTTTGCCGCTGCCGGGTCAGTTGCAGCCTCTCGATACGGCA
AAACCGAAGCCCGACAAGCGGGTGCCGACGGAACGGGTCGACGCCGCCAACAAGGTGGCGCTGATCGAAC
CTATGCGGGATGGCTATATCAATGCGATCCAGGTCTATCCCTTCGCCGAAGGAGCGCTTTACCGGCTCTA
TGCGGCACCGGAGCGCGTCAGCGATATCGCGCTGCAGCCGGGTGAGGAACTCATCGCCGTCTCGGCCGGC
GATACGGTGCGCTGGGTGATCGGCGACACAGTAAGTGGCAGCGGCGCCGGCAAACGTATTCATGTACTGG
TGAAGCCTTTCGCCGCCGGGCTCGAGACCAATCTCGTCATCACCACCGATCGACGTGCCTACCATCTGGC
GCTCGAAAGCACCGAGACGACGGCCATGGCCGCGCTCTCCTGGACCTATCCGCGGGACGAGCTGCTCGCC
CTGCAGGCGCGGAATGCGAGGGCCGAAGCATCGTCTGCAATTGCGGGCGGCGTCGATCTCGCCGCGCTCC
GCTTTCGCTACGAAATTACGGGCGACGATCCGCCCTGGCGGCCGCTCCGCGCCTTCGATGATGGCGCGAA
AGTCTATATCGAGTTTCCGGCGCGGCTCGATCAGGGCGAGGCGCCGCCGCTTTTCGTCGTCGGCCCGTCG
GGCGGCAGCGAACTCGTCAATTATCGCATGCGCGGCCACTACTACATTGTCGACCGGCTCTTCGCGGCGG
CGGAACTGCGGCTCGGCGAGGCACCGCAACAGGTGGTACGCATCAGCCGCGCGGACAGGGTGGTGAACAC
GGGCGACAACCGCCCCGCGCGGCTGCGGCCGGGACGATAG
 Primer design