SecReT4
Protein ID: 154253845
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3409
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3648888..3649508 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA7HYM9
KEGG IDpla:Plav_3409
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|154253845|ref|YP_001414669.1| hypothetical protein Plav_3409 [Parvibaculum lavamentivorans DS-1]
MFQDAELMCPTPPWFHHPERRLLAGVLGLLWSVLAGGCATTTAPPAPDVIEEVSAAPEPETPEYIPVVRY
GRYTLVELAPPAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCQTAHAVTELYALPLPAAHLH
LGPMTLRDALLTLAGPAWELHADDRARQICFERPADSAAIEPASEPSAADAVQTFPVEPSVSGGQL
 
Nucleotide Sequence: 621 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3648888-3649508 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGTTTCAGGACGCCGAGCTTATGTGCCCAACTCCACCTTGGTTTCACCATCCCGAACGCCGCCTGCTGG
CGGGAGTCCTCGGCCTGCTCTGGTCGGTGCTGGCTGGCGGTTGCGCGACGACGACTGCGCCACCCGCGCC
TGATGTCATCGAGGAAGTCTCGGCCGCACCCGAACCCGAGACGCCCGAGTACATCCCCGTTGTGCGTTAC
GGTCGCTACACGCTAGTCGAGCTAGCACCCCCGGCTGCACAGCGGGACCTGCTGTTGCAGACCATCGACG
TGTCCATGCCCGAAGATGCCCGCGCCACCGTCGGCGATGGGCTGCGGCATGTGCTCAAGCGCAGTGGTTA
CGGCCTGTGCCAGACGGCGCACGCGGTGACCGAGCTGTATGCCCTGCCGCTGCCGGCGGCGCACCTGCAC
CTCGGCCCCATGACCTTACGCGATGCGCTGCTCACACTGGCTGGCCCGGCTTGGGAACTGCACGCGGATG
ATCGCGCACGACAGATTTGCTTCGAACGGCCCGCCGACAGCGCGGCTATCGAACCTGCATCCGAGCCATC
CGCCGCCGACGCGGTGCAGACGTTCCCGGTGGAGCCTTCGGTTTCGGGAGGCCAGCTATGA
 Primer design