SecReT4
Protein ID: 154253847
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3411
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3650170..3650895 [+]
Productputative signal peptide
Component typeTfc3
UniProt IDA7HYN1
KEGG IDpla:Plav_3411
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|154253847|ref|YP_001414671.1| putative signal peptide [Parvibaculum lavamentivorans DS-1]
MQPSIILFALLLASAQLPAWAQQPATAPARNAQSQERPLVARTPDDKVASDWGLQPQEWTRYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQIEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPS
AGAVRGSGRMAVFVKDGCAACGQLVQRLQSSGTEFDLYMVGSRQDDARIRDWAKRAQIDPARVRSGSITL
NHDGGRWLSLGLPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3650170-3650895 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCAGCCGTCGATCATCCTTTTCGCGCTCCTGCTGGCATCCGCCCAGTTGCCCGCCTGGGCGCAGCAGC
CGGCCACCGCCCCGGCCCGCAATGCGCAGAGCCAGGAGCGTCCGCTGGTCGCCCGAACCCCAGATGACAA
GGTAGCAAGCGACTGGGGCCTGCAACCGCAGGAATGGACGCGCTATCGCGAGTTGATGGACGGGCCGCTA
GGCATCTACTCGCCCAACCTGGACCCGCTGTCCGCCTTGGGTATTGAGGCCCGCACCGACGAGGAACGGC
GGCGCTACGCAGAACTGCAGGTGCAAATCGAAGCGCGCCGCGTCGAGAAGCTGCTTGCCTATCAACGTGC
CTACGACGAAGCCTGGCAGCGCTTAAACCCCGGCATGCAACGGGTGAACCTGCCTGACGATAAGCCCAGC
GCCGGCGCAGTGCGCGGCAGCGGCCGCATGGCGGTGTTCGTCAAGGACGGCTGCGCGGCCTGCGGACAGC
TCGTGCAGCGCCTGCAATCCTCGGGTACCGAGTTCGACCTGTACATGGTCGGCAGCCGCCAGGACGATGC
ACGCATCCGTGATTGGGCCAAGCGCGCGCAAATCGATCCGGCCCGCGTGCGCAGCGGCAGCATCACGCTC
AACCACGACGGCGGCCGCTGGCTGTCGCTGGGCCTGCCCGGCGACTTACCAGCGGTCGTACGCGAGGTGA
ACGGCCAATGGCAGCGCCAACCCTGA
 Primer design