SecReT4
Protein ID: 154253848
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3412
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3650877..3651467 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDA7HYN2
KEGG IDpla:Plav_3412
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|154253848|ref|YP_001414672.1| lytic transglycosylase catalytic subunit [Parvibaculum lavamentivorans DS-1]
MAAPTLTAPLRALVVAAGLYVSTVYAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRIVPWPWS
LNVAGQSRRYTTRADACAGLQRAMRSTPHTRIDAGLGQINLGYHQQRYSTACDLLDPYRNLAIAAEILKE
QHTPGEDWLVAVGRYHRPAGGEPAARYRRSVSRHLARVQGARSTTAASAARQETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3650877-3651467 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGGCAGCGCCAACCCTGACGGCGCCGCTGCGCGCACTGGTGGTCGCTGCTGGCCTGTACGTCAGCACCG
TCTATGCCCAGGAGGTTCCGCCGCCGGCCTACCAGCTTGCCGCCCAGCGCGCGGGCATCCCTTCGACGGT
GCTCTACGCCGTGGCCCTGCAAGAGAGCGGTATCCGACGCAACGGGCGCATCGTCCCGTGGCCTTGGTCC
CTCAACGTCGCCGGCCAGTCGCGCCGCTACACGACCCGAGCCGACGCCTGCGCGGGTTTGCAGCGGGCGA
TGCGCTCGACGCCTCATACGCGCATCGACGCGGGCCTTGGGCAGATCAACCTCGGCTACCACCAGCAGCG
CTACAGCACCGCGTGCGACCTGCTTGACCCGTACCGCAACCTCGCCATCGCCGCCGAGATTCTGAAAGAA
CAGCACACCCCCGGTGAGGACTGGCTGGTGGCGGTCGGCCGTTACCACCGCCCCGCGGGTGGTGAGCCGG
CCGCCCGCTACCGGCGCAGCGTATCCCGCCACCTCGCCCGCGTGCAGGGTGCGCGCTCAACCACTGCGGC
GTCCGCCGCGCGCCAGGAGACCTCCCCATGA
 Primer design