SecReT4
Protein ID: 154253849
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3413
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3651464..3652012 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA7HYN3
KEGG IDpla:Plav_3413
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 2.1e-53, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|154253849|ref|YP_001414673.1| hypothetical protein Plav_3413 [Parvibaculum lavamentivorans DS-1]
MTKSHLAHLTFKGLLMLLTILPLASRAGVPLIVVEDRGGASALPYYEALNLQPRDNGAARSPIPMPQVPA
TPADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVIGDDKASRDWLQRHAGSLHERGAVGLVVNVETAQ
TLARLRALAPGVPLAPVAGDDLAERLGLRHYPALITATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3651464-3652012 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGACGAAATCCCATCTGGCCCATCTCACGTTCAAGGGCCTGCTCATGCTGCTGACGATCCTGCCGCTGG
CCTCGCGTGCCGGCGTGCCGCTGATCGTGGTCGAGGACCGTGGCGGTGCATCGGCGCTGCCGTACTACGA
AGCACTCAACCTCCAGCCGCGGGACAACGGTGCAGCGCGGTCGCCCATCCCGATGCCGCAGGTTCCCGCG
ACACCCGCGGATGAGGCTGCGATGCTGCCGGTGCGCAGCGCCAAGCTCACGCCCGGCACCGTCGCGCGAC
GGGTGATCGAGGCACCGGGCCTGCGGCCGTTCGTGGTCATTGGCGACGACAAGGCTTCCCGGGACTGGCT
GCAGCGCCATGCGGGCTCCTTGCACGAGCGCGGCGCGGTCGGCCTGGTGGTCAATGTCGAGACCGCACAA
ACCTTGGCGCGGCTGCGCGCACTGGCGCCCGGCGTGCCACTGGCACCCGTGGCGGGCGATGACCTGGCTG
AGCGTCTGGGCTTGAGGCACTACCCGGCGCTGATCACGGCCACCGGCATCGAGCAATGA
 Primer design