SecReT4
Protein ID: 154253850
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3414
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3652017..3654218 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDA7HYN4
KEGG IDpla:Plav_3414
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 9.4e-15, Aligned region: 507..637
TrwB_AAD_bind [PF10412], Evalue: 1.1e-09, Aligned region: 509..648
AAA_10 [PF12846], Evalue: 3.3e-09, Aligned region: 191..584
Protein Sequence: 733 a.a.     [Download]
>gi|154253850|ref|YP_001414674.1| hypothetical protein Plav_3414 [Parvibaculum lavamentivorans DS-1]
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPGMGVGSALAFGAYGAIRYRDARVILCYRR
NIRRLPRYVMTSRDVPVSQQRLFIGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLARRLEERLEFAP
FPLSRLPRLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNASGEHEVVIVIDPKGDADLLKRMYVEAKRVGREGEFYIFHLGWPEISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHFFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGTRVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HIVGLPKGQCFALLQGGQLWKIRMPLPAPDPDEAMPQDLQQLAGYMRQSYTDATQWWEFTSSPALQDAAL
PDDLLDDAELAKPVESAAAATGADDSAENEASP
 
Nucleotide Sequence: 2202 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3652017-3654218 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGTCGGGCAAACAGCCGGTTGAGGTTCTGCTTCGCCCTGCGGTGGAGCTATATACCGTCGCAGCGTGTG
CAGGTGCCGCGTTTCTGTCCCTGGTGGCCCCGTGGTCGCTCGCACTGAGCCCCGGCATGGGCGTCGGCAG
CGCGCTGGCGTTCGGCGCCTACGGTGCCATCCGCTACCGCGATGCCCGCGTGATCCTGTGCTATCGGCGC
AACATCCGCCGCCTGCCGCGGTACGTGATGACCAGCCGCGACGTGCCGGTCAGCCAGCAGCGGCTCTTCA
TCGGTCGGGGCTTTCTCTGGGAGCAGAAGCACACCCATCGGCTGATGCAGACGTACCGGCCGGAGTTTCG
CCGCTACGTTGAGCCGACACCCGCTTATCGGCTGGCGCGGCGTCTGGAAGAACGGTTGGAGTTCGCGCCG
TTTCCGCTTTCACGCCTGCCGAGGCTCACAGGCTGGGATGTGCCTTTCAACCCCGTTCGGCCGTTGCCGC
CCGTGGGGGGCCTGCCGCGATTGCACGGCATCGAGCCGGAGGAGGTGGACGTCAGCCTGCCGCTGGGCGA
GCGCGTCGGGCATTCGCTGGTCTTGGGCACCACCCGCGTGGGCAAGACCCGGCTGGCCGAGTTGTTCGTG
ACGCAGGACATCCGGCGCAAGAACGCATCCGGCGAGCATGAGGTCGTCATCGTCATCGACCCCAAGGGCG
ATGCCGACCTCCTGAAGCGCATGTACGTCGAGGCCAAGCGCGTGGGCCGCGAGGGTGAGTTCTACATCTT
CCATTTGGGCTGGCCGGAAATCAGCGCCCGCTACAACGCGGTGGGTCGCTTCGGTCGGATCTCGGAAGTG
GCGACACGCATCGCGGGACAGCTCTCCGGCGAAGGCAACAGCGCGGCATTCCGCGAGTTCGCATGGCGCT
TCGTCAACATCATCGCCCGCGCCTTGGTGGAACTGGGGCAGCGCCCGGACTACATGCTGATCCAGCGGCA
CGTCATCAACATCGACGCGCTGTTCATCGAGTACGCCCAGCACTTCTTCGCCAAGACCGAGCCCAAGGCC
TGGGAGGTGATCGTCCAGATCGAGGCCAAGCTCAATGAGAAGAACATCCCGCGCAACATGATCGGGCGCG
AGAAGCGCGTGGTGGCGCTGGAGCAGTACCTTTCCCAGGCGCGCAACTACGACCCGGTACTCGACGGCCT
GCGCTCTGCAGTCCGCTACGACAAGACGTACTTCGACAAGATCGTCGCATCGTTGCTGCCGCTGCTGGAG
AAGCTCACCAGCGGCAAGATCGCCCAGCTCCTGGCCCCGAACTACTCCGACCTGGCCGATCCGCGCCCGA
TCTTCGATTGGATGCAAGTCATCAGAAAGCGCGCCGTGGTCTATGTGGGCCTGGATGCGCTCTCGGACGC
TGAAGTCGCCGCAGCGGTCGGCAATTCCATGTTCTCGGATCTAGTATCCGTCGCAGGGCACATCTACAAG
CACGGGATCGATGATGGCTTACCCGGTGCATCGGCAGGCACACGCGTGCCGATCAACGTGCACGCGGACG
AATTCAATGAGTTGATGGGCGACGAGTTCATACCGCTCATCAACAAGGGTGGCGGCGCCGGCCTGCAAGT
TACTGCGTACACGCAGACGCTCTCGGACATTGAAGCCCGCATTGGCAACCGCGCGAAAGCCGGCCAGGTG
ATCGGCAACTTCAACAACCTGTTCATGCTCAGGGTCCGGGAGACGGCCACCGCCGAACTGCTGACCCGGC
AATTGCCGAAGGTCGAGGTCTATACGACCACCATCGTCTCCGGTGCGACCGACAGTTCGGACATCCGCGG
CGCGACGGATTTCACCAGCAACACGCAGGACCGTATCAGCATGTCCAGCGTGCCAATGATCGAGCCCTCC
CACATCGTCGGCCTGCCCAAGGGGCAGTGCTTCGCGCTGCTGCAGGGCGGCCAACTCTGGAAAATCAGGA
TGCCACTGCCGGCGCCGGACCCCGATGAGGCCATGCCGCAGGATCTGCAACAACTGGCGGGCTACATGCG
CCAGAGCTACACCGATGCCACCCAATGGTGGGAGTTCACCAGTTCCCCAGCCTTACAGGATGCGGCCTTG
CCCGACGATCTGCTCGATGACGCCGAGCTGGCCAAGCCGGTCGAGTCTGCCGCGGCGGCCACCGGCGCCG
ACGACAGCGCCGAAAACGAGGCCTCGCCATGA
 Primer design