SecReT4
Protein ID: 154253851
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3415
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3654215..3654964 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA7HYN5
KEGG IDpla:Plav_3415
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.9e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|154253851|ref|YP_001414675.1| hypothetical protein Plav_3415 [Parvibaculum lavamentivorans DS-1]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKEQGWRHSQQMLQYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARTPSQGQTRNFRYFISQVYVWAES
YLIAAAFTTLTFLVRLLVLALTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WITYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3654215-3654964 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAAAGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAAGGTCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTGATCGGCTCGCTGCTGTTCTCCATCGTGGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGAACAGGGCTGGCGCCATTCTCAGCAGATGTTGCAGTACGAACTGGGGCAC
CTGTCCAATCACTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGCACGGCGCACGAGCTGGTGGATA
CCGGCTACGAATGGGTGTTCGTGCGCTCGGGGCTGCTGGAACGCATGAGTCAGACCGCTGAGCGCGCCCG
CACGCCCAGCCAGGGACAGACGCGGAACTTTCGGTACTTCATCAGCCAGGTCTATGTCTGGGCCGAGAGC
TACCTGATTGCCGCCGCGTTCACGACGTTGACCTTTCTTGTGCGGCTGTTGGTTCTGGCGCTCACGCTGC
CCTTGATCTTCACGGCGGCATTCGTCGGGCTGATCGACGGCTTGGTTCGGCGTGACGTGCGTCGATTTGG
CGCCGGGCGTGAATCGGGCTTCATCTACCATCGTGCGAAAGCCAGCCTGATGCCGCTGGCCGTGCTGCCG
TGGATCACCTACCTGGCACTGCCGATCTCGGTGCATCCGCTGCTGATCCTCCTGCCGAGTGCCGCCTTGC
TGGGCTTGGCCGTGAGCCTGACCGCCGGCAGCTTCAAAAAGTATCTCTAG
 Primer design