SecReT4
Protein ID: 154253852
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3416
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3655063..3655446 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA7HYN6
KEGG IDpla:Plav_3416
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.1e-30, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|154253852|ref|YP_001414676.1| hypothetical protein Plav_3416 [Parvibaculum lavamentivorans DS-1]
MVASTWLRAAHRGVPTFLVTALLMGQSPMAVAESPAQRQELAGALRQLDALERTVTDSAAHTAVIPGERY
HFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELAGDYRTERPAEPLPATTAEGKP
 
Nucleotide Sequence: 384 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3655063-3655446 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGGTGGCTTCAACCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCCTGA
TGGGTCAGTCCCCGATGGCGGTGGCCGAGTCCCCGGCACAGCGCCAGGAACTGGCCGGCGCGCTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTGACCGACAGCGCCGCGCACACCGCCGTCATTCCGGGCGAGCGCTAC
CACTTCGACTACCCGCGGCTGCTGGCCGACCTGGCCCGCGTGCGCGCTGGCATCCAGGCCCATCTCACAC
CGTCGCGCGCCCAGCCGCGCGACCCCTCCGAACTGGCCGGCGACTATCGCACCGAGCGGCCGGCTGAGCC
GCTGCCGGCTACGACTGCGGAGGGCAAGCCATGA
 Primer design