SecReT4
Protein ID: 154253855
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3419
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3656064..3656474 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA7HYN9
KEGG IDpla:Plav_3419
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.5e-48, Aligned region: 10..134
Protein Sequence: 136 a.a.     [Download]
>gi|154253855|ref|YP_001414679.1| hypothetical protein Plav_3419 [Parvibaculum lavamentivorans DS-1]
MSEQQHVRADGTVTFLPHRLNRHPIVVRGLTADELWICCGLSGGAGLLIGAPLSWVSRTIALAPTFIVLG
VAFGVFVGGGILRRLKRGRPDTWLYRQLQWRIATKHPLAAGWVGGHVLISRSGFWTTRRSVARGTR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3656064-3656474 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACGGTCACGTTCCTTCCACACCGGCTCAACCGCCATC
CCATTGTGGTGCGCGGCCTTACCGCAGACGAACTGTGGATCTGCTGCGGCTTGTCTGGCGGCGCCGGCTT
GCTGATCGGCGCGCCGCTGTCCTGGGTGTCCCGCACCATTGCGCTGGCGCCCACATTCATCGTGCTGGGC
GTGGCGTTTGGTGTGTTCGTGGGCGGCGGTATCCTACGTCGGCTCAAGCGCGGCCGTCCCGACACCTGGC
TGTACCGGCAGTTGCAGTGGCGCATCGCCACGAAGCATCCGTTGGCTGCCGGCTGGGTGGGCGGCCACGT
GCTGATCTCGCGTTCCGGCTTCTGGACCACCCGAAGGTCTGTTGCAAGGGGGACGCGATGA
 Primer design