SecReT4
Protein ID: 154253856
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3420
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3656471..3657160 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA7HYP0
KEGG IDpla:Plav_3420
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3.7e-90, Aligned region: 6..206
Protein Sequence: 229 a.a.     [Download]
>gi|154253856|ref|YP_001414680.1| hypothetical protein Plav_3420 [Parvibaculum lavamentivorans DS-1]
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQQLNRWPTNGEEDYPRNLHALSPYLTPACHAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRVVSDRDWVVTLDISADEYYGAEQVKRALVRYPIKVTRVDVDPSRNPFGLALDCYDGTPQRINVPE
PTRPTSGRLPSQAPQGETP
 
Nucleotide Sequence: 690 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3656471-3657160 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAGCCGTTTCAAGAACGAGATCACCCACCTGCAGGCGCACATTAAGACGCTGCGCCTGGGCGCGGGCG
CGCTGGTCATCGTCGCGCTGGTCATGGGTGGCGGTTGGTGGAGTGCCCCGCGCGATCTGACCATCCACGT
CCCGCCTGACCTGCGCTCCGGCAGCACCCGCAAGTGGTGGGAAGTGCCACCCGAATCGGTCTATGCCTTC
ACGTTCTACGTGTTCCAGCAGCTCAACCGCTGGCCGACCAATGGCGAGGAAGACTACCCGCGCAACCTGC
ACGCGCTCTCGCCATACCTCACGCCAGCCTGTCACGCCTTTCTGCGTGCCGACTACGACTACCGGCGCAG
CACCGGCGAGCTGCGCCAGCGCGTGCGCGGCATCTATGAAATCCCGGGCCGTGGTTATGGCGACGATCCC
ACCGCCCGCGTGCGCGTCGTCTCCGACCGCGACTGGGTGGTGACGCTAGACATCAGCGCCGACGAGTATT
ACGGCGCTGAGCAGGTCAAGCGCGCCCTGGTGCGCTACCCCATCAAAGTCACGCGGGTGGACGTCGATCC
CTCACGCAACCCGTTCGGCCTGGCGCTCGATTGCTACGACGGCACGCCCCAGCGCATCAACGTCCCGGAG
CCGACGCGCCCGACATCTGGCAGGTTGCCTTCGCAAGCGCCTCAAGGAGAAACCCCATGA
 Primer design