SecReT4
Protein ID: 154253857
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3421
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3657157..3658083 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA7HYP1
KEGG IDpla:Plav_3421
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.5e-124, Aligned region: 11..291
Protein Sequence: 308 a.a.     [Download]
>gi|154253857|ref|YP_001414681.1| hypothetical protein Plav_3421 [Parvibaculum lavamentivorans DS-1]
MKHSLQHYSLALLGLLAVALASAAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAAVGERLRVQ
SAGGAVYLRASEPIEPARLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGNTASARYGGQPAGADK
VSARSGDSTGAPPARRETPVAVVLTRFAAQNLYAPLRTVEPLAGVMRVNLRRNLDLGTLMPTLSVRAVAL
ASWRLEDQWVTAVRLTNSSAAWITLDPRVLQGDFLTATFQHEALGPRGTPEDTTTVYLVTRGRGLAQSLL
PAIHRFDPAVHLPQPNADENGKEARHAQ
 
Nucleotide Sequence: 927 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3657157-3658083 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAAGCACTCCTTACAGCATTACTCCCTCGCCTTGCTGGGGCTGCTGGCCGTGGCCTTGGCATCTGCGG
CCCAGGCGGTGGAGATCCTGCGCTGGGAGCGCATGCCGCTGGCCGTTCCCCTGAAGGTCGGCCAGGAGCG
CATTGTGTTCATCGACCGGAACGTGCGCGTGGGCGTGCCGGCCGCCGTGGGCGAGCGCCTGCGGGTGCAG
AGCGCGGGCGGCGCGGTGTACCTGCGCGCCAGCGAGCCAATCGAGCCCGCACGGCTGCAACTGCAAGACG
CCGACACGGGCGCATTGATCCTGCTGGACATTGCGGCCGAGCCGCCCAAGGACGGCGAAGCGGAGCTGGA
GCCGGTGCGCATCGTCGAGGGCAATACCGCTTCAGCGCGCTATGGCGGTCAGCCAGCGGGCGCCGATAAA
GTGTCGGCACGCTCTGGTGATTCGACGGGCGCGCCGCCGGCCCGGCGCGAAACGCCGGTCGCGGTCGTGC
TGACGCGGTTTGCCGCGCAGAACCTGTACGCACCGCTGCGTACGGTTGAGCCACTTGCGGGCGTGATGCG
CGTCAACCTGCGCCGCAACCTGGACCTCGGCACGCTGATGCCGACGTTGTCGGTGCGCGCCGTCGCGCTC
GCATCCTGGCGCTTGGAGGATCAGTGGGTCACTGCCGTGCGTCTCACGAACAGCAGTGCCGCCTGGATCA
CGCTCGACCCGCGCGTGCTGCAAGGCGATTTCCTCACCGCCACTTTCCAGCATGAGGCGTTGGGCCCGCG
CGGCACACCGGAGGACACCACCACCGTGTACCTGGTAACGCGCGGGCGGGGCCTTGCGCAATCGCTGCTG
CCCGCCATTCACCGCTTCGACCCGGCCGTGCATCTGCCGCAACCGAATGCGGATGAGAACGGCAAGGAGG
CCCGTCATGCGCAGTAA
 Primer design