SecReT4
Protein ID: 154253858
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3422
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3658073..3659482 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDA7HYP2
KEGG IDpla:Plav_3422
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 469 a.a.     [Download]
>gi|154253858|ref|YP_001414682.1| hypothetical protein Plav_3422 [Parvibaculum lavamentivorans DS-1]
MRSNGLLKWLMIPVALLVLFIGVRLFSGGGPSTLSQADAGSQLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALSDNKSQREENQRLRQRENSIDQRINAALEAERSNLRRDQQQAASERQQTEGLLADLQRRL
EAIGGRGGGHADLPVGLGLRDGDEAGMEGGVRWVEPDDAKKAEARGSSSGAMSFPTSFGPAQRTLETTAE
TVANAGARAAGVKTAKAVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPD
VAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDREGNQQNNQQRDGLGWISDPYGIPCVSGE
RRSNAQQYLGSQALITAAGAGVASLIESDSGQMSYVGSDGSIGTVGISGQEAVGRILAGGVQEMSNWVNK
LYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELD
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3658073-3659482 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCGCAGTAACGGACTCCTGAAGTGGCTGATGATCCCAGTGGCCCTCCTGGTGCTGTTCATCGGCGTCC
GTCTGTTCTCGGGCGGCGGACCTTCGACACTTTCCCAAGCCGACGCGGGGAGCCAGCTCACGCCCGAAGA
GATGAAGGCGCTGGGCATCGAGGGCGATACCCCGCGCGATACCGTCGCCACGCTGGTCGCGCAGGTCAAG
CAACTGCGCACCGAGCTTCAGACCGCGCTGTCCGACAACAAGTCTCAGCGCGAGGAAAACCAACGCCTGC
GCCAGCGCGAGAACTCGATCGATCAGCGCATCAACGCCGCGCTCGAAGCCGAGCGTTCCAACCTGCGGCG
CGACCAGCAGCAAGCCGCGAGCGAGCGCCAGCAAACCGAAGGCTTGCTCGCGGACTTGCAGCGACGCCTG
GAGGCGATCGGCGGTCGTGGCGGCGGCCATGCCGACCTGCCGGTGGGCCTGGGACTGCGCGACGGCGACG
AGGCCGGGATGGAAGGCGGCGTGCGCTGGGTGGAACCGGACGACGCGAAGAAGGCTGAGGCGCGCGGCTC
GTCCAGTGGCGCCATGAGCTTTCCGACGAGCTTTGGACCGGCGCAGCGCACGCTGGAAACCACGGCGGAA
ACCGTGGCGAACGCGGGCGCACGCGCCGCCGGCGTCAAGACCGCCAAGGCTGTTTATACGGTTCCGACAA
ACTCCACCCTCATGGGATCGGTGGCGATGACCGCGCTAATCGGCCGTGTGCCGATCGACGGCACCGTGAA
CGACCCGTACCCCTTCAAAGTCCTGGTGGGCCCCGACAACCTCACGGCCAACGGCATCGATATTCCCGAC
GTGGCGGGCGCCGTGTTCAGCGGCACAGCCTCGGGCGACTGGACGCTCTCGTGCGTGCGCGGCCAGGTGC
GCAGCATTACGTTCGTCTTTCATGACGGAACCATCCGCACCATTCCCGAGGACCGCGAGGGCAACCAGCA
GAACAACCAGCAACGCGATGGCCTGGGCTGGATCAGCGATCCCTATGGCATTCCCTGCGTCAGTGGGGAG
CGGCGCAGCAACGCCCAGCAGTACCTCGGTTCGCAGGCCCTGATCACCGCGGCCGGTGCCGGCGTGGCCT
CGCTCATCGAAAGCGACAGCGGCCAGATGTCCTACGTCGGCTCGGACGGCTCCATCGGCACTGTGGGCAT
CAGTGGTCAGGAGGCCGTGGGCCGGATTCTCGCCGGTGGCGTCCAGGAAATGTCGAACTGGGTCAACAAG
CTCTACGGGCAGGCCTTCGCCGCCGTCTATGTGCAGCCCGGCGCGAAAGTCGCTGTCCACCTCGAAAAAC
CCCTTGCCATCGACTTCGACCCCGAGGGTCGCAAGGTCGATCACCGCGCAGGAGAAAGCCATGCTCTCGA
ACTTGACTGA
 Primer design