SecReT4
Protein ID: 154253859
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3423
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3659463..3659912 [+]
Productputative signal peptide
Component typeTfc15
UniProt IDA7HYP3
KEGG IDpla:Plav_3423
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|154253859|ref|YP_001414683.1| putative signal peptide [Parvibaculum lavamentivorans DS-1]
MLSNLTDLTRGLALAVAVAVLGGCATSKEKLLPHGSSTMMDIWQQEAGDGGGGAGQVARRQLLDARQSLR
RPLTEADVQAAPSEQMRYTRTARNEVYRQFQRLPNPDLVMYVFPHLAGTDPIPVPGYTTVFPLYQRTQYA
MPGERVEDY
 
Nucleotide Sequence: 450 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3659463-3659912 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCTCTCGAACTTGACTGACTTGACCCGTGGCCTTGCGCTGGCCGTTGCCGTTGCGGTGCTCGGCGGCT
GCGCCACCAGCAAGGAAAAGCTGCTGCCCCACGGTAGCAGCACGATGATGGACATTTGGCAGCAGGAAGC
CGGCGACGGTGGCGGCGGTGCTGGCCAGGTAGCGCGCAGGCAATTGCTCGATGCGCGTCAAAGCCTGCGT
CGGCCGCTGACCGAAGCGGACGTGCAGGCCGCACCTTCTGAGCAGATGCGCTACACGCGCACGGCGCGCA
ACGAAGTCTATCGCCAATTTCAGCGCCTGCCGAATCCCGACCTTGTGATGTATGTGTTCCCCCACCTGGC
GGGCACCGACCCCATACCTGTGCCGGGCTACACGACCGTTTTCCCCCTGTACCAGCGTACCCAGTACGCC
ATGCCGGGCGAGCGCGTGGAGGATTATTGA
 Primer design