SecReT4
Protein ID: 154253860
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3424
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3659912..3662782 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDA7HYP4
KEGG IDpla:Plav_3424
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.1e-66, Aligned region: 61..335
AAA_10 [PF12846], Evalue: 4.3e-46, Aligned region: 529..868
Protein Sequence: 956 a.a.     [Download]
>gi|154253860|ref|YP_001414684.1| hypothetical protein Plav_3424 [Parvibaculum lavamentivorans DS-1]
MRWKLSWPKLAASSAGDEEQPDGWKRHVEALRQAGIPEPGSAVRGRRSATVADEQALYDVAPSFVELLPW
VEFLPESKAMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDEHPWVLQLYAQDEA
SFDQYMQTLRDYVQPRARDTAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQSRRVRMVVYRRSS
GQASRRGQTPEQMLNIVCDRLCGGLANAGIQARRMVATDVHDWLLRWFNPNPALLGPAVEDRERFYALAR
YPDETEDGEIELASGRDFSQRLFFGQPRSDVARGTWTFDGMPHRVLITDRLRMPPGAGHLTGETRKGDAI
NTLFDQMPEDTLMCLTMVATPQDVLESDLNHLAKKAVGETLASEQTLKDVHEARSLIGSAHKLYRGTLAF
YLRGRDEAELNRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPSQDRRKWYTQLMFAQHAAN
LSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPR
LFIVEAGNSFGLFSEFARRLGLTVNRVKLAPGSGVTLAPFADARRLIETPSDVQTLDADALDEELPPDAS
AMEPDEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAERCVAKRRTVLTRDVRDALRA
RGNDSTLPEMRRVRLLEMADAMDMFCQGTDGEMFDRDGSPWPEADITLVDLATYAREGYNAQLSIAYISL
ISTVNNIAERDQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPML
NMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAVPPSLYLALAQ
TEPEEKAERYQLMQQYGITELEAAFKVAENIDQARGIESPALDLPQ
 
Nucleotide Sequence: 2871 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3659912-3662782 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCGCTGGAAACTCTCTTGGCCGAAGCTGGCCGCATCCAGTGCTGGCGATGAAGAGCAACCGGACGGCT
GGAAGCGCCATGTTGAGGCCTTGCGCCAGGCCGGTATTCCCGAACCCGGCTCGGCGGTCCGCGGGCGCAG
GTCGGCAACGGTGGCCGACGAGCAGGCGCTGTACGACGTCGCGCCTTCGTTCGTGGAACTGCTGCCTTGG
GTGGAGTTCCTGCCCGAGTCGAAGGCCATGCTGCTGGAGGACGGGCAATCGGTCGCGGCCTTCTACGAGT
TGGTGCCGCTGGGCACCGAGGGCCGGGAACCCGGCTGGCTCGCACATGCCCGGGATGCCCTGGAGAATGC
GCTGCAAGACAGCTTCGATGAATTGGACGAGCACCCCTGGGTACTCCAGCTCTACGCCCAGGACGAGGCC
AGCTTCGACCAGTACATGCAGACCCTGCGCGACTACGTGCAGCCGCGCGCACGCGATACAGCTTTCACCG
AGTTCTACCTGCGCTTTTTCGGTCATCACCTGCGCGCGGTGGCCAAGCCGGGTGGCCTGTTCGAGGACAC
CGTGGTCACGCGCCTGCGCTGGCGCGGCCAAAGCCGGCGTGTACGGATGGTGGTCTATCGGCGTTCCAGC
GGACAGGCGAGCCGCCGTGGCCAGACGCCGGAGCAGATGCTCAATATCGTCTGCGATCGCCTGTGTGGTG
GCTTGGCCAACGCCGGTATTCAGGCCCGGCGTATGGTCGCAACCGACGTTCACGACTGGCTGCTGCGGTG
GTTCAACCCCAATCCCGCGTTGCTCGGGCCTGCGGTCGAGGACCGCGAGCGCTTCTATGCGTTGGCACGC
TATCCCGATGAGACCGAAGACGGCGAGATCGAACTGGCGAGCGGACGGGATTTCAGCCAACGGTTGTTCT
TTGGGCAACCGCGCTCCGACGTAGCGCGCGGTACCTGGACCTTCGACGGCATGCCGCACCGCGTGCTGAT
CACCGACCGGCTACGGATGCCACCCGGCGCCGGGCATCTGACCGGAGAGACCCGCAAGGGCGATGCGATC
AACACGCTGTTCGACCAGATGCCCGAAGACACCTTGATGTGCCTGACGATGGTCGCCACACCGCAGGATG
TCCTCGAATCGGATTTGAATCACCTGGCGAAGAAGGCCGTGGGCGAAACCCTGGCATCCGAGCAGACGCT
CAAGGATGTGCACGAGGCCCGTTCGCTCATCGGCAGCGCGCACAAGCTCTACCGGGGCACGCTGGCGTTC
TACCTGCGCGGGCGTGACGAAGCCGAGCTGAACCGTCGCGGGCTGGATCTGGCGAACGTGATGCTCAACG
CCGGCTTGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCGCTCAACAGCTACCTGCGCTGGCTGCCGTG
CTGCTACAACCCCAGCCAAGACCGGCGCAAGTGGTACACGCAACTCATGTTCGCCCAGCACGCGGCGAAT
CTGTCGCCGGTATGGGGCCGTGCTCAGGGCACCGGGCACCCCGGCATCACGATGTTCAACCGCGGCGGCG
GCCCGATCACTTTCGACCCGCTCAACCGCCTGGACCGACAGATGAATGCCCATCTGTTCCTGTTCGGCCC
AACCGGCTCGGGCAAAAGCGCCACGCTCAACAACCTGCTGAACCAGGTCACGGCCATCTACCGGCCGCGG
CTCTTCATCGTGGAGGCTGGCAACAGCTTCGGTTTGTTCAGCGAATTTGCCAGGCGTTTGGGTCTGACGG
TCAACCGCGTGAAGCTGGCCCCTGGCTCGGGCGTGACCCTGGCGCCGTTTGCCGATGCGCGCCGGCTGAT
CGAGACACCCAGCGACGTGCAAACGCTCGATGCCGATGCGCTGGACGAAGAGCTGCCACCCGATGCCTCG
GCCATGGAGCCGGACGAGCAACGCGACGTACTGGGCGAGTTGGAGATCACCGCGCGGTTGATGATCACAG
GTGGGGAAGACAAGGAAGAAGCCCGCATGACGCGGGCCGACCGCTCGCTGATCCGCCAGTGCATTCTGGA
TGCTGCCGAGCGCTGCGTGGCCAAGAGGCGCACGGTGCTCACGCGTGATGTGCGTGATGCGTTGCGCGCG
CGGGGCAACGACAGCACGCTGCCAGAGATGCGGCGCGTGCGGCTGCTGGAGATGGCGGACGCAATGGACA
TGTTCTGCCAGGGCACGGATGGCGAGATGTTCGATCGGGACGGTTCCCCTTGGCCCGAGGCCGACATCAC
TCTGGTGGATCTCGCGACCTATGCTCGCGAGGGCTACAACGCGCAGCTCTCCATCGCGTACATCAGCCTG
ATCAGCACGGTGAACAACATCGCCGAGCGCGACCAGTATCTGGGCCGACCGATCGTCAATGTGACCGACG
AAGGCCACATCATCACCAAGAACCCGTTGCTCGCGCCCTACGTCGTGAAGATCACGAAGATGTGGCGCAA
GTTGGGCGCGTGGTTCTGGCTCGCGACGCAGAACATTGACGATCTGCCCCGTGCCGCAGAACCCATGCTC
AACATGATCGAGTGGTGGATCTGCCTGTCGATGCCGCCGGACGAGGTGGAGAAGATCGCGCGCTTTCGCG
AACTCTCGCCCGCGCAGAAGGCGTTGATGCTTTCCGCACGCAAGGAAGCAGGGAAATTCACCGAAGGCGT
GATCCTGTCGAAGTCGATGGAGGTGCTGTTTCGGGCCGTACCGCCAAGCCTCTACCTCGCACTCGCGCAG
ACCGAACCCGAGGAGAAGGCCGAACGCTACCAGCTCATGCAGCAGTACGGCATCACCGAACTGGAGGCGG
CCTTCAAGGTGGCCGAGAACATCGACCAGGCACGCGGCATCGAGTCGCCGGCCCTGGACCTGCCGCAATA
G
 Primer design